DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and Neurog2

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_008759703.1 Gene:Neurog2 / 295475 RGDID:1309061 Length:263 Species:Rattus norvegicus


Alignment Length:303 Identity:85/303 - (28%)
Similarity:116/303 - (38%) Gaps:95/303 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSNTYELHN--------------YADLNDMARATD-SKDSRKRKTASARGEKYSLRQKRQKRGS 50
            :||.|.||..              .|.|..|:.:.| .:|...|:..:|||      |:..:.|.
  Rat     3 VKSETLELKEEEEVLMLLGSASPASATLTPMSSSADEEEDEELRRPGAARG------QRGAEAGQ 61

  Fly    51 NEDGESANLAD-----------FQLELDPI-AEPASKSRKNAPTKSKTKAPPLSKYRRKTANARE 103
            ...|.||:.|.           .:.:..|. |...|:..|.|.|..:.|     |.||..||.||
  Rat    62 GVQGSSASGAGGCRPGRLLGLVHECKRRPSRARAVSRGAKTAETVQRIK-----KTRRLKANNRE 121

  Fly   104 RTRMREINTAFETLRHCVPEAIKGEDAANTNEKLTKITTLRLAMKYITMLTDSIRDPSYESEFIG 168
            |.||..:|.|.:.||..:|..  .|||     |||||.|||.|..||..||:::|...:.:.  |
  Rat   122 RNRMHNLNAALDALREVLPTF--PEDA-----KLTKIETLRFAHNYIWALTETLRLADHCAG--G 177

  Fly   169 ECLEESANREARVDLEANEEAEVELPVPVAKKPAKTKGSGKKSSAASKRQSQKQAKIVPQIPPIS 233
            ..|:.:...||                 |...|....|:...|                  |..|
  Rat   178 GSLQGALFSEA-----------------VLLSPGAALGASGDS------------------PSPS 207

  Fly   234 SGESCYATSSIGSPASSAYASLSSSSNSHS---SSSSPGLELD 273
            |..||     ..|||||     |:|::.:|   |.:|||.::|
  Rat   208 SSWSC-----TNSPASS-----SNSTSPYSCTLSPASPGSDVD 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 28/58 (48%)
Neurog2XP_008759703.1 HLH 110..169 CDD:238036 32/70 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.