DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and Neurod4

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001099412.2 Gene:Neurod4 / 288821 RGDID:1310434 Length:330 Species:Rattus norvegicus


Alignment Length:324 Identity:77/324 - (23%)
Similarity:118/324 - (36%) Gaps:84/324 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKS-NTYELHNYADLNDMARATDSKDSRKRKTASARGEKYSLRQKRQKRGSNEDGESANLADFQL 64
            ||| :..||.|.....|...::.::...:.:...:.|...:|.::.......|:.|         
  Rat     6 MKSKDMVELVNTQSWMDKGLSSQNEMEEQERRPGSYGMLGTLMEEHDSIEEEEEEE--------- 61

  Fly    65 ELDPIAEPASKSRKNAPTKSKTKAPPLSKY--RRKTANARERTRMREINTAFETLRHCVPEAIKG 127
                  |...|.::..|.|.|.....|.::  ||..|||||||||..:|.|.:.||..:|     
  Rat    62 ------EDGDKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMP----- 115

  Fly   128 EDAANTNEKLTKITTLRLAMKYI-------------------TMLTDSIRDPSYESEFIGECLE- 172
              ..:..:||:||.|||||..||                   .||...:..|:  |..:..||: 
  Rat   116 --CYSKTQKLSKIETLRLARNYIWALSEVLETGQTLEGKGFVEMLCKGLSQPT--SNLVAGCLQL 176

  Fly   173 --ESANREARVDLEANEEAEVEL---------------------PVPVAKKPAKTKGSGKKSSAA 214
              :||..|.|.:.....::.|.:                     |:.:..:|.|:.|....|...
  Rat   177 GPQSALLEKREEKSPICDSTVSVHSFNYQSPGLPSPPYGHMETHPLHLKPQPFKSLGDSFGSHPP 241

  Fly   215 SKRQSQKQAKIVPQIPPIS-SGESCYATSSIGSPASSA-------YASLS-SSSNSHSSSSSPG 269
            .......:.   |..||:| ||.  ::....|||....       |.|.| ||.:.||:....|
  Rat   242 DCSTPPYEG---PLTPPLSISGN--FSLKQEGSPDLEKSYNFMPHYTSASVSSGHVHSTPFQTG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 28/77 (36%)
Neurod4NP_001099412.2 bHLH_TS_NeuroD4_ATOH3 59..145 CDD:381564 34/107 (32%)
Neuro_bHLH 146..263 CDD:403655 22/123 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.