DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and FERD3L

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_690862.1 Gene:FERD3L / 222894 HGNCID:16660 Length:166 Species:Homo sapiens


Alignment Length:145 Identity:40/145 - (27%)
Similarity:66/145 - (45%) Gaps:29/145 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SLRQKRQKRGSN-EDGESANLADFQLELDP---IAEPASKSRKNAPTKSKTKAPPLSKY-RRKTA 99
            :||:.|.:|.:. |:|:.   .:.:.|:|.   ..|...:..:......:.|...:..| :|:.|
Human    45 ALREGRPRRMARFEEGDP---EEEECEVDQGDGEEEEEEERGRGVSLLGRPKRKRVITYAQRQAA 106

  Fly   100 NARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKLTKITTLRLAMKYITMLTDSIRDPSYES 164
            |.|||.||..:|.||:.||..||       .....::|::|.|||||:.||:.:|          
Human   107 NIRERKRMFNLNEAFDQLRRKVP-------TFAYEKRLSRIETLRLAIVYISFMT---------- 154

  Fly   165 EFIGECLEESANREA 179
                |.||....:|:
Human   155 ----ELLESCEKKES 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 24/58 (41%)
FERD3LNP_690862.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..88 5/33 (15%)
bHLH_TS_FERD3L_NATO3 94..157 CDD:381421 27/83 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.