DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and lin-32

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_508410.2 Gene:lin-32 / 191703 WormBaseID:WBGene00003018 Length:142 Species:Caenorhabditis elegans


Alignment Length:95 Identity:34/95 - (35%)
Similarity:50/95 - (52%) Gaps:7/95 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DPIAEPASKSRKNAPTKSKTKAPPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAA 131
            |.::....|..|....:.||.:|.|.:.||..||.|||.||..:|.|::.||..:||...|    
 Worm    45 DSLSNGGGKDDKKKCRRYKTPSPQLLRMRRSAANERERRRMNTLNVAYDELREVLPEIDSG---- 105

  Fly   132 NTNEKLTKITTLRLAMKYITMLTDSIRDPS 161
               :||:|..||::|.|||..|:..::..|
 Worm   106 ---KKLSKFETLQMAQKYIECLSQILKQDS 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 25/58 (43%)
lin-32NP_508410.2 HLH 73..124 CDD:278439 25/57 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.