DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and Neurod2

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_035025.3 Gene:Neurod2 / 18013 MGIID:107755 Length:383 Species:Mus musculus


Alignment Length:372 Identity:94/372 - (25%)
Similarity:132/372 - (35%) Gaps:119/372 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SRKRKTASARG-------------EKYSLRQKRQKRGSNEDGESANLADFQLELDPIAEPASKSR 77
            :|..|..|.||             |:..|..:.::....|:|           ||. || ..:.:
Mouse    52 ARAAKPVSLRGGEEIPEPTLAEVKEEGELGGEEEEEEEEEEG-----------LDE-AE-GERPK 103

  Fly    78 KNAPTKSK-TKAP-PLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKLTKI 140
            |..|.|.| |||. ..||.||:.||||||.||.::|.|.:.||..||       ..:..:||:||
Mouse   104 KRGPKKRKMTKARLERSKLRRQKANARERNRMHDLNAALDNLRKVVP-------CYSKTQKLSKI 161

  Fly   141 TTLRLAMKYITMLTDSIRD------PSY-----------ESEFIGECL---------EESANREA 179
            .|||||..||..|::.:|.      .||           .:..:..||         |:.|:...
Mouse   162 ETLRLAKNYIWALSEILRSGKRPDLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNFLTEQGADGAG 226

  Fly   180 RVDLEANEEAEVELPVPVAKKPAKTKGSGKKSSAASKRQSQKQAKIVPQIPPISSGESCYATSSI 244
            |........|....|.|.::                                 .:|..|.|...:
Mouse   227 RFHGSGGPFAMHPYPYPCSR---------------------------------LAGAQCQAAGGL 258

  Fly   245 GSPAS---------SAYASL------SSSSNSHSSSSSPGLELDSLVGLNGISALDSLLLDTSDG 294
            |..|:         :||.:|      ..:|..::||...| .|...:.|||..   ||..|:|..
Mouse   259 GGGAAHALRTHGYCAAYETLYAAAGGGGASPDYNSSEYEG-PLSPPLCLNGNF---SLKQDSSPD 319

  Fly   295 DSLSCLSPGYGSLLTGS---GESLLPG---CRGDLPMSGLEKSDVEL 335
            ...|.....:.|.|.||   |..|:.|   .||.:....|...|:.|
Mouse   320 HEKSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLSYDMHL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 27/58 (47%)
Neurod2NP_035025.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..130 26/90 (29%)
bHLH_TS_NeuroD2 89..181 CDD:381563 44/111 (40%)
Nuclear localization signal. /evidence=ECO:0000255 108..114 2/5 (40%)
Neuro_bHLH 181..311 CDD:372170 26/166 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.