DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and Neurod1

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_035024.1 Gene:Neurod1 / 18012 MGIID:1339708 Length:357 Species:Mus musculus


Alignment Length:313 Identity:76/313 - (24%)
Similarity:112/313 - (35%) Gaps:103/313 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DSRKRKTASARGEKYSLRQKRQKRGSNEDGESANLADFQLELDPIAEPASKSRKNAPTKSKTKAP 89
            |.::.:..:...|:.|||     .|..|:.|..:|.:.:.|.:  .|...|.::..|.|.|....
Mouse    37 DKKEDELEAMNAEEDSLR-----NGGEEEEEDEDLEEEEEEEE--EEEDQKPKRRGPKKKKMTKA 94

  Fly    90 PLSKY--RRKTANARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKLTKITTLRLAMKYITM 152
            .|.::  ||..||||||.||..:|.|.:.||..||       ..:..:||:||.|||||..||..
Mouse    95 RLERFKLRRMKANARERNRMHGLNAALDNLRKVVP-------CYSKTQKLSKIETLRLAKNYIWA 152

  Fly   153 LTDSIR---DPSYES--------------EFIGECLEESANREARVDL-EANEEAEVELPVPVAK 199
            |::.:|   .|...|              ..:..||:    ...|..| |.|.:....||...|.
Mouse   153 LSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQ----LNPRTFLPEQNPDMPPHLPTASAS 213

  Fly   200 KPAKTKGSGKKSSAASKRQSQKQAKIVPQIPPISSGESCYATSSIGSPASSAYASLSSS------ 258
            .|                           :.|       |:..|.|.| |..|.::.||      
Mouse   214 FP---------------------------VHP-------YSYQSPGLP-SPPYGTMDSSHVFHVK 243

  Fly   259 --SNSHSSSSSPGLELDSLVGLNGISALDSLLLDTSDGDSLSCLSPGYGSLLT 309
              .:::|::..|..|              |.|.|        |.||.:...|:
Mouse   244 PPPHAYSAALEPFFE--------------SPLTD--------CTSPSFDGPLS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 27/58 (47%)
Neurod1NP_035024.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..94 15/63 (24%)
Nuclear localization signal. /evidence=ECO:0000255 87..93 2/5 (40%)
HLH 100..158 CDD:238036 28/64 (44%)
Neuro_bHLH 160..284 CDD:289310 31/176 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.