DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and ngn-1

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_500236.1 Gene:ngn-1 / 177045 WormBaseID:WBGene00003595 Length:184 Species:Caenorhabditis elegans


Alignment Length:256 Identity:65/256 - (25%)
Similarity:88/256 - (34%) Gaps:96/256 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DMARATDSKDSRKRKTASARGEKYSLRQKRQKRGSNEDGESANLADFQLELDPIAEPASKSRKNA 80
            ||.|..|...:.|..|     :|...|:||:.|                           .||.:
 Worm    20 DMERENDMDQNSKNST-----QKPVKREKRRYR---------------------------CRKRS 52

  Fly    81 PT---KSKTKAPPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKLTKITT 142
            |.   ::||       .||..||||||.||..:|.|.|.||..:|       |.....|:|||.|
 Worm    53 PATIERAKT-------VRRDKANARERRRMNSLNDALEHLRGILP-------ALPDEPKMTKIET 103

  Fly   143 LRLAMKYITMLTDSIRDPSYESEFIGECLEESANREARVDLEANEEAEVELPVPVAKKPAKTKGS 207
            ||.|.:||..|:..:...|.:|   .:|.|                               |...
 Worm   104 LRKAQEYIASLSFQLSGGSPDS---SQCCE-------------------------------TGSC 134

  Fly   208 GKKSSAASKRQSQKQAKIVPQIPPISSGESCYATSSIGSPASSAYASLSSSSNSHSSSSSP 268
            |..|::.|.:.:..|:...||  |:.      ..||..:|.|..|     ..:.|.|.|.|
 Worm   135 GLCSASQSLQSTPFQSPCFPQ--PLQ------YPSSYSNPPSQMY-----YHHHHQSPSFP 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 27/58 (47%)
ngn-1NP_500236.1 bHLH_SF 63..119 CDD:381792 28/62 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.