DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and OLIG3

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_786923.1 Gene:OLIG3 / 167826 HGNCID:18003 Length:272 Species:Homo sapiens


Alignment Length:290 Identity:74/290 - (25%)
Similarity:107/290 - (36%) Gaps:77/290 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSNTYELHNYADLNDM---------ARATDSKDSRKRKTASARGEKYSLRQKRQKRGSNEDGES 56
            |.|::..:.:.|...||         .|....::||....:|.:|:   :.||.       .|||
Human     1 MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGD---MMQKM-------PGES 55

  Fly    57 ANLADFQLELDPIAEPASKSRKNAPTKSKTKAPPLSKYRRKTANARERTRMREINTAFETLRHCV 121
            .:.|.        |:.|.:|.| ...|.:.....|.:.|.| .|.|||.||.::|.|.:.||..:
Human    56 LSRAG--------AKAAGESSK-YKIKKQLSEQDLQQLRLK-INGRERKRMHDLNLAMDGLREVM 110

  Fly   122 PEAIKGEDAANTNEKLTKITTLRLAMKYITMLTDSIRDPSYESEFIGECL--EESANREARVDLE 184
            |.| .|...    .||:||.||.||..||.|||.|:.:   ....:||..  ..||.....|...
Human   111 PYA-HGPSV----RKLSKIATLLLARNYILMLTSSLEE---MKRLVGEIYGGHHSAFHCGTVGHS 167

  Fly   185 ANEEAEVELPVPVAKKPAKTKGSGKKSSAASKRQSQKQAKIVPQIPPISSGESCYATSSIGSPAS 249
            |...|..                               |..|..:.||..|  ..::.:..||.|
Human   168 AGHPAHA-------------------------------ANSVHPVHPILGG--ALSSGNASSPLS 199

  Fly   250 SA-YASLSSSSNSHS----SSSSPGLELDS 274
            :| ..::.:....||    .|:.|.|:|.|
Human   200 AASLPAIGTIRPPHSLLKAPSTPPALQLGS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 26/58 (45%)
OLIG3NP_786923.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 20/88 (23%)
HLH 85..138 CDD:306515 26/58 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.