DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and Bhlhe23

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_542372.2 Gene:Bhlhe23 / 140489 MGIID:2153710 Length:223 Species:Mus musculus


Alignment Length:241 Identity:61/241 - (25%)
Similarity:83/241 - (34%) Gaps:70/241 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SARGEKY-SLRQKRQKRGSNEDGESANLADFQLELDPIA----------------EPASKSRKNA 80
            :|.|..| :.|.....||....|...:|........|.|                |...:.|.:.
Mouse    20 TATGHAYAAARGPETTRGFGASGPGGDLPAAPASRVPAATVESSGEQSGDEDEAFERRRRRRGSG 84

  Fly    81 PTKSKTKAPPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKLTKITTLRL 145
            ......:.|...:..|.:.|||||.||.::|.|.:.||..:|.|     .:.:..||:||.||.|
Mouse    85 VAVDARRRPREQRSLRLSINARERRRMHDLNDALDGLRAVIPYA-----HSPSVRKLSKIATLLL 144

  Fly   146 AMKYITMLTDSIRDPSYESEFIGECLEESANREARVDLEANEEAEVELPVPVAKKPAKTKGSGKK 210
            |..||.|.              .:.|||.....|.::....      |..|||..|....|    
Mouse   145 AKNYILMQ--------------AQALEEMRRLVAYLNQGQG------LAAPVAAAPLTPFG---- 185

  Fly   211 SSAASKRQSQKQAKIVPQIPPISSG-------ESCYATSSIGSPAS 249
                       ||.|.    |.|:|       :.| ||.| |||::
Mouse   186 -----------QAAIY----PFSAGTALGPCPDKC-ATFS-GSPSA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 25/58 (43%)
Bhlhe23NP_542372.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..93 8/60 (13%)
HLH 104..158 CDD:197674 25/72 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.