DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and AgaP_AGAP001741

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_321345.3 Gene:AgaP_AGAP001741 / 1281434 VectorBaseID:AGAP001741 Length:282 Species:Anopheles gambiae


Alignment Length:136 Identity:44/136 - (32%)
Similarity:63/136 - (46%) Gaps:22/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KYSLRQKRQKR---GSNEDGES-ANLA--DFQLELDPIAEPASKSRKNAPT---------KSKTK 87
            :|:.:.|.:..   |:..|..| |:|:  .|...|.|.|...:.......|         |.|..
Mosquito   154 QYNRKPKAKPEPPSGAETDATSRADLSCLTFPKSLFPRAADPNNVHSEGTTGAVGVIGKRKRKQV 218

  Fly    88 APPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKLTKITTLRLAMKYITM 152
            .|.:.|.||..||||||.||:.:|.||:.||..:|..  |.|     .:|:|..||::|..|||.
Mosquito   219 PPQIKKKRRLAANARERKRMQNLNDAFDRLRQYLPSL--GND-----RQLSKHETLQMAQTYITA 276

  Fly   153 LTDSIR 158
            |.|.::
Mosquito   277 LCDLLQ 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 26/58 (45%)
AgaP_AGAP001741XP_321345.3 HLH 223..282 CDD:238036 29/65 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.