DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and AgaP_AGAP004907

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_314998.4 Gene:AgaP_AGAP004907 / 1275714 VectorBaseID:AGAP004907 Length:142 Species:Anopheles gambiae


Alignment Length:166 Identity:43/166 - (25%)
Similarity:68/166 - (40%) Gaps:50/166 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YELHNYADLNDMARATDSKDSRKRKTASAR-----------------GEKYSLRQKRQKRGSNED 53
            |::.:..:|:..|...     ||.:|.||:                 |....:||::|:    :|
Mosquito     3 YQMKDPMELSSCAVGV-----RKPRTKSAQLCTPSHDHLPAGQPPVYGSAGPVRQRKQQ----QD 58

  Fly    54 GESANLADFQLELDPIAEPASKSRKNAPTKSKTKAPPLSKYRRKTANA-RERTRMREINTAFETL 117
            ..|....:|    ..:.....:.|:.|..          |||  ||:| |||.|:...|.||..|
Mosquito    59 PSSIQTTEF----SNLTREERRRRRRATL----------KYR--TAHATRERIRVEAFNVAFSEL 107

  Fly   118 RHCVPEAIKGEDAANTNEKLTKITTLRLAMKYITML 153
            |..:|       ....::||:||..|:||:.||:.|
Mosquito   108 RKLLP-------TLPPDKKLSKIEILKLAICYISYL 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 24/60 (40%)
AgaP_AGAP004907XP_314998.4 HLH 84..140 CDD:238036 26/62 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.