DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and Neurod4

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001316418.1 Gene:Neurod4 / 11923 MGIID:108055 Length:330 Species:Mus musculus


Alignment Length:319 Identity:80/319 - (25%)
Similarity:116/319 - (36%) Gaps:83/319 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YADLNDMARATDSKDSRKRKTASARGEKYSLRQKRQKRGSNEDGESANLADFQLELDPI------ 69
            |....||....::: |...|..|::.|     .|.|:|.....|....|.:   |.|.|      
Mouse     5 YMKSKDMVELVNTQ-SWMDKGLSSQNE-----MKEQERRPGSYGMLGTLTE---EHDSIEEDEEE 60

  Fly    70 AEPASKSRKNAPTKSKTKAPPLSKY--RRKTANARERTRMREINTAFETLRHCVPEAIKGEDAAN 132
            .|...|.::..|.|.|.....|.::  ||..|||||||||..:|.|.:.||..:|       ..:
Mouse    61 EEDGDKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMP-------CYS 118

  Fly   133 TNEKLTKITTLRLAMKYI-------------------TMLTDSIRDPSYESEFIGECL------- 171
            ..:||:||.|||||..||                   .||...:..|:  |..:..||       
Mouse   119 KTQKLSKIETLRLARNYIWALSEVLETGQTLEGKGFVEMLCKGLSQPT--SNLVAGCLQLGPQST 181

  Fly   172 ------EESANREARVDLEANEEAEVELPVP-----------VAKKPAKTKGSGKKSSAASKRQS 219
                  |:|:..::.:.:.:.......||.|           :..:|.|:.|....|........
Mouse   182 LLEKHEEKSSICDSTISVHSFNYQSPGLPSPPYGHMETHSLHLKPQPFKSLGDSFGSHPPDCSTP 246

  Fly   220 QKQAKIVPQIPPIS-SGESCYATSSIGSPASSA-------YASLS-SSSNSHSSSSSPG 269
            ..:.   |..||:| ||.  ::....|||....       |.|.| ||.:.||:....|
Mouse   247 PYEG---PLTPPLSISGN--FSLKQDGSPDLEKSYNFMPHYTSASLSSGHVHSTPFQTG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 28/77 (36%)
Neurod4NP_001316418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..80 16/64 (25%)
HLH 88..144 CDD:238036 27/62 (44%)
Neuro_bHLH 146..263 CDD:289310 21/123 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.