DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and Neurod6

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_033847.1 Gene:Neurod6 / 11922 MGIID:106593 Length:337 Species:Mus musculus


Alignment Length:298 Identity:81/298 - (27%)
Similarity:119/298 - (39%) Gaps:64/298 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NDMAR--ATDSKDSRKRKTASARGEKYSLRQKRQKRGSNEDGESANLADFQLELDPIAEPASKSR 77
            :.|.|  |...:|.::.|...:..::..||.|..||...|:.|.....:.:.|.|    ....||
Mouse    15 SQMCRKFARQCEDQKQIKKPESFPKQVVLRGKSIKRAPGEETEKEEEEEDREEED----ENGLSR 75

  Fly    78 KNAPTKSKTKAPPLS--KYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKLTKI 140
            :....|.||....|.  |:||:.||||||.||..:|.|.:.||..||       ..:..:||:||
Mouse    76 RRGLRKKKTTKLRLERVKFRRQEANARERNRMHGLNDALDNLRKVVP-------CYSKTQKLSKI 133

  Fly   141 TTLRLAMKYITMLTDSIRDPSYESEFIGECLEESANREARVDLEANEEAEVELPVPVAKKPAKTK 205
            .|||||..||..|::.:|        ||:          |.||           :...:...|..
Mouse   134 ETLRLAKNYIWALSEILR--------IGK----------RPDL-----------LTFVQNLCKGL 169

  Fly   206 GSGKKSSAASKRQSQKQAKIVPQIPPISSGESCYATSSIGSPASSAYASLSSSSNSHSSSSSPGL 270
            .....:..|...|...::.::.|     .||:.:.|.   ||.|:.|...    :|...::.||.
Mouse   170 SQPTTNLVAGCLQLNARSFLMGQ-----GGEAAHHTR---SPYSTFYPPY----HSPELATPPGH 222

  Fly   271 -ELD---SLVGLNGISALDSLLLDTSDGDSLSCLSPGY 304
             .||   |:...|..||.:|....||.    .|.||.:
Mouse   223 GTLDNSKSMKPYNYCSAYESFYESTSP----ECASPQF 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 27/58 (47%)
Neurod6NP_033847.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..80 12/55 (22%)
Nuclear localization signal. /evidence=ECO:0000255 80..86 3/5 (60%)
bHLH_TS_NeuroD6_ATOH2 82..151 CDD:381565 32/75 (43%)
Neuro_bHLH 153..272 CDD:372170 30/141 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.