DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and Ptf1a

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_446416.1 Gene:Ptf1a / 117034 RGDID:621709 Length:326 Species:Rattus norvegicus


Alignment Length:175 Identity:48/175 - (27%)
Similarity:80/175 - (45%) Gaps:25/175 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AEPASKSRKNAPTKSKTKAPPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAANTN 134
            |..|:.:|:....:|:.:...|    |:.||.|||.||:.||.|||.||..:|       .....
  Rat   142 AAAAAAARRRRRVRSEAELQQL----RQAANVRERRRMQSINDAFEGLRSHIP-------TLPYE 195

  Fly   135 EKLTKITTLRLAMKYITMLTDSIR-DPSYESEFIGECLEESANREARVDLEANEEAEVELPVPVA 198
            ::|:|:.|||||:.||..|::.:: |........|.|.....:|....|...|:..:|.:.....
  Rat   196 KRLSKVDTLRLAIGYINFLSELVQADLPLRGSGTGGCGGPGGSRHLGGDSPGNQAQKVIICHRGT 260

  Fly   199 KKPAKTKG-------SGKKSSAASKRQSQKQ-----AKI-VPQIP 230
            :.|:.:..       :|...|.|.::|.::|     ||: .|:.|
  Rat   261 RSPSPSDPDYGLPPLAGHSLSWADEKQLKEQNIIRTAKVWTPEDP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 25/58 (43%)
Ptf1aNP_446416.1 bHLH_TS_PTF1A 164..218 CDD:381423 26/60 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..249 4/19 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..326 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.