DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and OLIG2

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_005797.1 Gene:OLIG2 / 10215 HGNCID:9398 Length:323 Species:Homo sapiens


Alignment Length:259 Identity:69/259 - (26%)
Similarity:104/259 - (40%) Gaps:84/259 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 ASKSRKNAPTKSKTKAPPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKL 137
            ||.::|:   |.:...|.|.:.|.| .|:|||.||.::|.|.:.||..:|.| .|...    .||
Human    91 ASSTKKD---KKQMTEPELQQLRLK-INSRERKRMHDLNIAMDGLREVMPYA-HGPSV----RKL 146

  Fly   138 TKITTLRLAMKYITMLTDSIRD-PSYESEFIG---------EC--LEESANREARVDLEANEEAE 190
            :||.||.||..||.|||:|:.: ....||..|         .|  |..||               
Human   147 SKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSA--------------- 196

  Fly   191 VELPVPVAKKPAKTKGSGKKSSAASKRQSQKQAKIVPQIPPISSGESCYATSSIGSPASSAYASL 255
               |:|.|          ....||:...:...|...|.:||                 ::|.|:.
Human   197 ---PLPAA----------TAHPAAAAHAAHHPAVHHPILPP-----------------AAAAAAA 231

  Fly   256 SSSSNSHSSSSSPGLELDSLVGLNGISALDSL-----LLDTSDGDSLSCLSPGYGSLLTGSGES 314
            ::::.:.||:|.||         :|:.::.|:     ||.:....:.:.|..|.|    |||.|
Human   232 AAAAAAVSSASLPG---------SGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGG----GSGAS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 26/58 (45%)
OLIG2NP_005797.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..107 5/18 (28%)
bHLH_TS_OLIG2 95..179 CDD:381510 35/92 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.