DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and neurog2

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_002934289.2 Gene:neurog2 / 100493110 XenbaseID:XB-GENE-491040 Length:213 Species:Xenopus tropicalis


Alignment Length:201 Identity:55/201 - (27%)
Similarity:87/201 - (43%) Gaps:32/201 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KDSRKRKTASARGEKYSLRQKRQKRGSNEDGE-----SANLADFQLELDPIAEPASKSR---KNA 80
            :|..:..|:::.....|......:..|::|.:     |..|...|.:....:.|:.:||   ||.
 Frog     9 RDEEEELTSASPCSVSSSHMSPAQTCSSDDEQLLSPTSPALMHLQAQEQENSPPSRRSRPRTKNG 73

  Fly    81 PTKSKTKAPPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKLTKITTLRL 145
            .|..|.|     |.||..||.|||.||..:|:|.::||..:|..  .|||     |||||.|||.
 Frog    74 ETVLKVK-----KTRRIKANNRERNRMHHLNSALDSLREVLPSL--PEDA-----KLTKIETLRF 126

  Fly   146 AMKYITMLTDSIRDPSYESEFIGECLEESANREARVDLEANEEAEVELPV-PVAKKPAKTKGSGK 209
            |..||..|::::|           ..|..::......:...:.:..:.|. ..:..|:.:.||..
 Frog   127 AYNYIWALSETLR-----------LAEHGSSASTLSPMSVQDSSPSQSPSWSCSSSPSSSCGSFS 180

  Fly   210 KSSAAS 215
            .:|.||
 Frog   181 PASPAS 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 28/58 (48%)
neurog2XP_002934289.2 bHLH_TS_NGN2_ATOH4 74..142 CDD:381560 34/90 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5227
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.