DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and ube2e2

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001119983.1 Gene:ube2e2 / 100144938 XenbaseID:XB-GENE-5800934 Length:201 Species:Xenopus tropicalis


Alignment Length:171 Identity:39/171 - (22%)
Similarity:66/171 - (38%) Gaps:44/171 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 SANREARVDLEANEEAEVELPVPVAKKPAK-TKGSGKKSSAASKRQSQKQAKIVPQIPPISS--- 234
            |::.:.|..::..::.|...|   .||..| :..:..|.|.::||..::.|:|....||..|   
 Frog    18 SSDGDQRDGVQNEQDREKVQP---KKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGP 79

  Fly   235 -GESCYA-TSSIGSPASSAY------ASLSSSSN--------------SHSSSSSPGLELDSLVG 277
             |::.|. .|:|..|..|.|      ..::.|.:              .|.:.:|.|:....::.
 Frog    80 KGDNIYEWRSTILGPPGSVYEGGVFFLDIAFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILK 144

  Fly   278 LNGISALD---------SLLLDTSDGDSLSCLSPGYGSLLT 309
            .|...||.         |||.|.:..|      |..||:.|
 Frog   145 DNWSPALTISKVLLSICSLLTDCNPAD------PLVGSIAT 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439
ube2e2NP_001119983.1 UQ_con 59..196 CDD:365926 29/127 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.