DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and neurog1

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001116895.1 Gene:neurog1 / 100144651 XenbaseID:XB-GENE-491452 Length:227 Species:Xenopus tropicalis


Alignment Length:262 Identity:70/262 - (26%)
Similarity:98/262 - (37%) Gaps:82/262 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ATDSKDSRKRKTASARGEKY--SLRQKRQKRGSNEDGESANLADFQLELDPIAEPASKSRKNAPT 82
            ::|.:||...::||....::  |..|..:|....:|                   ..|.|..:..
 Frog    18 SSDEEDSFSMQSASPFSSEHMSSPAQTPEKCQEEKD-------------------KRKKRVRSRV 63

  Fly    83 KSKTKAPPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKLTKITTLRLAM 147
            |:......:.|.||..||.|||.||..:|:|.:.||..:|       :...:.|||||.|||||.
 Frog    64 KNDAVLHTIKKTRRVKANDRERNRMHNLNSALDELRGILP-------SFPDDTKLTKIETLRLAH 121

  Fly   148 KYITMLTDSIR--DPSYESEFIGECLEESANREARVDLEANEEAEVELPVPVAKKPAKTKGSGKK 210
            .||..|::::|  |.|.|                                    ||.|..|    
 Frog   122 NYIWALSETLRLADQSKE------------------------------------KPLKNLG---- 146

  Fly   211 SSAASKRQSQKQAKIVPQIPPISSGESCYATSSIGSPASSAYASLSSSSNSHSSSSSPGLELDSL 275
                      ..|.:.|..|| |.|....:..|..||:||: :|.||.|...||.|||.:..|..
 Frog   147 ----------HPAYLSPATPP-SPGSDAESWMSSSSPSSSS-SSSSSFSVCTSSPSSPAMSEDCY 199

  Fly   276 VG 277
            .|
 Frog   200 YG 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 26/58 (45%)
neurog1NP_001116895.1 HLH 73..132 CDD:238036 28/65 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5227
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.