DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tx and neurod1

DIOPT Version :9

Sequence 1:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001090868.1 Gene:neurod1 / 100038290 XenbaseID:XB-GENE-963757 Length:361 Species:Xenopus tropicalis


Alignment Length:306 Identity:76/306 - (24%)
Similarity:111/306 - (36%) Gaps:80/306 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DMARATDSKDSRKRKTASARGEKYSLRQKRQKRGSNEDGESANLADFQLELDPIAEPASKSRKNA 80
            |.....|.:||..........|:..:..:.::...:||.|.              :...|.::..
 Frog    42 DSLMKEDDEDSLNHHNGEENEEEDEVDDEEEEDDDDEDDED--------------DDDQKPKRRG 92

  Fly    81 PTKSK-TKA-PPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGEDAANTNEKLTKITTL 143
            |.|.| ||| ....|.||..||||||.||..:|.|.:.||..||       ..:..:||:||.||
 Frog    93 PKKKKMTKARVERFKVRRMKANARERNRMHGLNAALDNLRKVVP-------CYSKTQKLSKIETL 150

  Fly   144 RLAMKYITMLTDSIR---DPSYES--EFIGECLEESANREARVDLEAN-----EEAEVELPVPVA 198
            |||..||..|::.:|   .|...|  :.:.:.|.:.........|:.|     .|...::|    
 Frog   151 RLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQSQDIP---- 211

  Fly   199 KKPAKTKGSGKKSSAASKRQSQKQAKIVPQIPPISSGESCYATSSIGSPASSAYASLSSSSNSHS 263
                    |..::|:||          .|..|        :...|.|.| |..|.::.||...|.
 Frog   212 --------SHMQASSAS----------FPLHP--------FPYQSPGLP-SPPYGTMDSSHVFHV 249

  Fly   264 SSSSPGLELDSLVGLNGISALDSLLLDTSDGDSLSCLSPGYGSLLT 309
            ...|.|..|:..        .||.:.|        |.||.:...|:
 Frog   250 KPHSYGSALEPF--------FDSTVTD--------CTSPSFDGPLS 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
txNP_001287543.1 HLH 95..154 CDD:278439 27/58 (47%)
neurod1NP_001090868.1 bHLH_TS_NeuroD1 82..167 CDD:381562 37/105 (35%)
Neuro_bHLH 167..288 CDD:372170 31/160 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.