powered by:
Protein Alignment Ald2 and LOC112694756
DIOPT Version :9
Sequence 1: | NP_001247314.1 |
Gene: | Ald2 / 43189 |
FlyBaseID: | FBgn0039425 |
Length: | 364 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001352233.1 |
Gene: | LOC112694756 / 112694756 |
-ID: | - |
Length: | 139 |
Species: | Homo sapiens |
Alignment Length: | 80 |
Identity: | 18/80 - (22%) |
Similarity: | 25/80 - (31%) |
Gaps: | 9/80 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 130 DLANRCAQYKKEGCSFAKWRCILKITKNTPSPQAILENA---NVMARYAAICQSQRLVPIISPEV 191
|.::.|.:....|.....|.|........|||...|:.. ...|.:|..| .|..|:.....
Human 57 DGSSPCRKQGSSGPPDCCWTCAEACNFPLPSPAHFLDACCPQPTRADWAPRC--PRCCPLCDCAC 119
Fly 192 LATGDHDLDRCQKVN 206
.. .|..||.:|
Human 120 TC----QLPDCQSLN 130
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Ald2 | NP_001247314.1 |
Glycolytic |
15..357 |
CDD:278692 |
18/80 (23%) |
LOC112694756 | NP_001352233.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.960 |
|
Return to query results.
Submit another query.