DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk15 and ppk30

DIOPT Version :9

Sequence 1:NP_001097937.1 Gene:ppk15 / 43188 FlyBaseID:FBgn0039424 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster


Alignment Length:349 Identity:82/349 - (23%)
Similarity:132/349 - (37%) Gaps:72/349 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 TDACAKCPSDNYRQI--------LTW--YGA---NCSDLFVECKLSHEPFDCCRHFLPLLTPFGR 212
            |...|:...:|:.:.        .:|  |.|   ||...|.||:...:..:||..|.|..|..|.
  Fly   117 TPMSARLTDENFTEFSELENWNAQSWGIYQALQMNCQHFFTECQWRRKAMNCCDLFRPTKTFNGF 181

  Fly   213 CYMLNSLLNNEPGSKHWLPNELDPAHQKAVINVITRLDVQISVINAED-IPHTAFFPPGIPLITE 276
            .:..|||:::  |.....|..:......:.:||..:....:..:|... |.|.       |....
  Fly   182 AFEFNSLVSS--GRDETWPWSVASCGSYSGLNVKIKRQQGLYTLNTMGVIVHE-------PTQLL 237

  Fly   277 GLS-KYMQFNQVAMKNDP-------DVKDIDPKIRSCFFPEEIPADSLYKSYSFSVCITECIRRL 333
            |:| .|...:::.:..:|       ||:....::|.|:|..|||...     |.|.||.:|....
  Fly   238 GMSIDYSSEDRIVVPVEPLHFTAELDVRARPVQMRRCYFENEIPTGK-----SRSECIYKCHVNY 297

  Fly   334 QMKACNCTSFLYNPNADPRYPD-------------CDLEGFLCLEKTRM-------IKPDSRVLV 378
            .:..|||:  |..|....:..|             |.::...|..:.|:       |..:||   
  Fly   298 IISKCNCS--LELPVKATQDEDNIAAAKESNGRRICGVKDLACFNQHRLSLFSMSNIIEESR--- 357

  Fly   379 NNNKGNNASCGCLPSCNDGDITTIYEPLLFVRNPNKYYNGT----LDMPFLPTD--QYRRQSLRT 437
             :|..:...|||.|.|..    |.|....:....:.:.|..    :|:.|....  .||.....|
  Fly   358 -DNVFSTVDCGCFPQCGH----TQYHTSTYTEKMSAHTNLAAAIEIDVYFQEETLFSYRSMLRFT 417

  Fly   438 PLDVVVSMGGMLGLFLGASILSAI 461
            .:|::||.||:.||.:|.|:|..|
  Fly   418 LIDLMVSYGGIAGLIMGISVLGCI 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk15NP_001097937.1 ASC 27..466 CDD:279230 82/349 (23%)
ppk30NP_001263076.1 ASC 47..446 CDD:279230 82/349 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.