DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk15 and asic1b

DIOPT Version :9

Sequence 1:NP_001097937.1 Gene:ppk15 / 43188 FlyBaseID:FBgn0039424 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_999956.1 Gene:asic1b / 407672 ZFINID:ZDB-GENE-040513-1 Length:557 Species:Danio rerio


Alignment Length:330 Identity:81/330 - (24%)
Similarity:127/330 - (38%) Gaps:83/330 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 DLFVECKLSHEPFDC-CRHFLPLLTPFGRCYMLNS-------LLNNEPGSKHWLPNELDPAHQKA 241
            |:.:||..:.:  :| ..|:..:.|.:|:||..||       |:..:.|..:.|...|| ..|..
Zfish   202 DMLLECNFAGK--ECGAEHWREIFTRYGKCYTFNSGQDGRPLLITTKGGMGNGLEIMLD-IQQDE 263

  Fly   242 VINVITRLD---------VQISVINAEDIPHTAFFPPGIPLITEGLSKYMQFNQVAMKNDPDVKD 297
            .:.|....|         |||         ||...||.|..:..|::.  .|.......:..:..
Zfish   264 YLPVWGETDETTFEAGIKVQI---------HTQDEPPFIDQLGFGVAP--GFQTFVSCQEQRLTY 317

  Fly   298 IDPKIRSCFFPEEIPADS-LYKSYSFSVCITECIRRLQMKACNCTSFLYNPNADP-----RYPDC 356
            :.|....|   :..|.|| .:.:||.:.|..:|..|..::.||| ..::.|...|     :|.:|
Zfish   318 LPPPWGDC---KATPIDSDFFNTYSITACRIDCETRYLVENCNC-RMVHMPGDAPYCTPEQYKEC 378

  Fly   357 DLEGFLCLEKTRMIKPDSRVLVNNNKGNNASCGCLPSCNDGDITTIYEPLLFVRNPNKYYNGTLD 421
                         ..|....||..   :|..|.|...||   :|...:.|.|||.|:|.....|.
Zfish   379 -------------ADPALDFLVER---DNDYCVCETPCN---MTRYGKELSFVRIPSKASAKYLA 424

  Fly   422 MPFLPTDQYRRQSLRTPLDV---------------------VVSMGGMLGLFLGASILSAIE-FV 464
            ..:..|:||...::.. ||:                     :..:||.:|||:|||||:.:| |.
Zfish   425 KKYNKTEQYISDNIMV-LDIFFEALNYETIEQKKAYELAGLLGDIGGQMGLFIGASILTILELFD 488

  Fly   465 YYFTV 469
            |.:.|
Zfish   489 YLYEV 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk15NP_001097937.1 ASC 27..466 CDD:279230 79/325 (24%)
asic1bNP_999956.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..57
ASC 66..548 CDD:295594 81/330 (25%)
Selectivity filter. /evidence=ECO:0000305 477..479 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.