DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk15 and ASIC2

DIOPT Version :9

Sequence 1:NP_001097937.1 Gene:ppk15 / 43188 FlyBaseID:FBgn0039424 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_899233.1 Gene:ASIC2 / 40 HGNCID:99 Length:563 Species:Homo sapiens


Alignment Length:551 Identity:115/551 - (20%)
Similarity:186/551 - (33%) Gaps:198/551 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IKDYCTNCTLAGFAYIANSRLHFMERIFWLICVFMSSLGCYQLIMG-------YQRSFP--TRAV 79
            ::..|...|.||.:        |..|..|:: .|.:|.|   |::.       |..|||  ||..
Human    69 LRHMCAGRTAAGGS--------FQRRALWVL-AFCTSFG---LLLSWSSNRLLYWLSFPSHTRVH 121

  Fly    80 SIVYESLPPFSKWKFPAVSVC-------------ELAYRGN----LFPK--FEEYITSLGVDVTG 125
            ......||      ||||:||             :|.|.|:    |.|.  ....::.|   :.|
Human   122 REWSRQLP------FPAVTVCNNNPLRFPRLSKGDLYYAGHWLGLLLPNRTARPLVSEL---LRG 177

  Fly   126 DYP--------YDVETGVSILLFPALYNENGLKGKCGTVHKNCTDACAKCPSDNYRQILTWYGAN 182
            |.|        .|..     |..|..:.| |:..                      ..:...|..
Human   178 DEPRRQWFRKLADFR-----LFLPPRHFE-GISA----------------------AFMDRLGHQ 214

  Fly   183 CSDLFVECKLSHEPFDCCRH-FLPLLTPFGRCYMLNSLLNNEPGSKHWLPNELDPAHQKAVINVI 246
            ..|:.:.||...|.  |..| |..:.|.:|:|||.||   .|.|              |.::..:
Human   215 LEDMLLSCKYRGEL--CGPHNFSSVFTKYGKCYMFNS---GEDG--------------KPLLTTV 260

  Fly   247 -----TRLDVQISVINAEDIP------------------HTAFFPPGIPLITEGLSKYMQFNQVA 288
                 ..|::.:.:...|.:|                  |:...||.|..:..|::.  .|....
Human   261 KGGTGNGLEIMLDIQQDEYLPIWGETEETTFEAGVKVQIHSQSEPPFIQELGFGVAP--GFQTFV 323

  Fly   289 MKNDPDVKDIDPKIRSC--------FFPEEIPADSLYKSYSFSVCITECIRRLQMKACNCTSFLY 345
            ...:..:..:.|....|        |||          .||.:.|..:|..|..::.||| ..::
Human   324 ATQEQRLTYLPPPWGECRSSEMGLDFFP----------VYSITACRIDCETRYIVENCNC-RMVH 377

  Fly   346 NPNADP-----RYPDCDLEGFLCLEKTRMIKPDSRVLVNNNKGNNASCGCLPSCNDGDITTIYEP 405
            .|...|     ::.:|             .:|...:|.  .|.:| .|.|...||   :|...:.
Human   378 MPGDAPFCTPEQHKEC-------------AEPALGLLA--EKDSN-YCLCRTPCN---LTRYNKE 423

  Fly   406 LLFVRNPNKYYNGTLDMPFLPTDQYRRQSLRTPLDV---------------------VVSMGGML 449
            |..|:.|:|.....|:..|..:::|..:::.. ||:                     :..:||.:
Human   424 LSMVKIPSKTSAKYLEKKFNKSEKYISENILV-LDIFFEALNYETIEQKKAYEVAALLGDIGGQM 487

  Fly   450 GLFLGASILSAIE---FVYYFTVRPLSNMLG 477
            |||:|||||:.:|   ::|......|.::||
Human   488 GLFIGASILTILELFDYIYELIKEKLLDLLG 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk15NP_001097937.1 ASC 27..466 CDD:279230 111/535 (21%)
ASIC2NP_899233.1 ENaC 64..547 CDD:273304 115/551 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.