DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk15 and ppk26

DIOPT Version :10

Sequence 1:NP_001097937.1 Gene:ppk15 / 43188 FlyBaseID:FBgn0039424 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_648125.3 Gene:ppk26 / 38835 FlyBaseID:FBgn0035785 Length:597 Species:Drosophila melanogaster


Alignment Length:59 Identity:12/59 - (20%)
Similarity:24/59 - (40%) Gaps:7/59 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEE------CTVAWG 74
            ||.| .::.|.:|.:..::.......|..::..|.|:.::|...|..      ..:.||
  Fly   228 RFAV-IFSVVIVWLYAYILTIGGAYSNTEINTQISCRTDRAGIISASPWIRVPHPIQWG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk15NP_001097937.1 ASC 27..466 CDD:459966 9/54 (17%)
ppk26NP_648125.3 ASC 74..570 CDD:459966 12/59 (20%)

Return to query results.
Submit another query.