DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk15 and ppk29

DIOPT Version :9

Sequence 1:NP_001097937.1 Gene:ppk15 / 43188 FlyBaseID:FBgn0039424 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster


Alignment Length:454 Identity:114/454 - (25%)
Similarity:183/454 - (40%) Gaps:69/454 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FMER--IFWLICVFMSSLGCYQLIM----GYQRSFPTRAVSIVYESLPPFSKW--KFPAVSVCEL 102
            |:|.  :.|:..:.:|......:::    .|:....|..||..|      |:|  .||::.:|..
  Fly    16 FVENKGLLWIFVIGISGWSTVSILVLLKTRYETDSTTIGVSTAY------SRWINTFPSIGICLT 74

  Fly   103 AYRGNLFPKFEEYITSLGVDVTGDYPYDVETGVSILLFPALYNENGLKGKCGTVHK------NCT 161
            ..|.     |.|:...:......|:.:..   ..::...|..|.|.:..|..|.:.      |..
  Fly    75 KSRA-----FNEFKAMMREYFQEDFAFSF---TRMIYEYAFLNPNNIFTKEPTKNTSYPYNFNIL 131

  Fly   162 DACAKCPSDNYRQILTWYGANCSDLFVECKLSHE-PFDCCRHFLPLLTPFGRCYMLNSLLNNEPG 225
            |...|           .:..||::.|.|.....| ..||...|...:|..|.|::.|:||:.:  
  Fly   132 DIRRK-----------MFPTNCTECFKEIYFRGELVTDCEEIFKFHVTEMGYCFLANNLLDYD-- 183

  Fly   226 SKHWLPNELDPAHQKAVINVITRLDV----QISVINAEDIPHTAFFPPGIPLITEGLSKYMQFNQ 286
            |...:|...........:.:..|..|    ::.|.:.||:|   ||......|:...:.| .||.
  Fly   184 SIEEMPLRYSSLDNNRSLRLYMRSSVMYKYEMYVNSPEDLP---FFNSLTYTISTDPTTY-AFNV 244

  Fly   287 VAMKNDPDVKDIDPKIRSCFFPEEIPADSLYKSYSFSVCITECIRRLQMKACNCTSFLYNPNADP 351
            ..:.|...|.|.....|.|.||.|...:..  .||||.|::......:||.|:|:  |:||....
  Fly   245 EEIHNHEGVIDEPISQRKCKFPSESSIEGF--PYSFSACMSIIRSEFEMKTCDCS--LFNPKDRN 305

  Fly   352 RYPDCDLEGFLCLEKTRMIKPDSRVLVNNNKGNNASCGCLPSCNDGDITTIYEPLLFVRNPNKYY 416
            ....|.|:...||     ||......|....|  :|..|||||.:..|:.:.   :...|...|.
  Fly   306 ESLYCGLQHADCL-----IKEGFATRVKEYVG--SSTVCLPSCVEQQISLVG---VITENGTLYN 360

  Fly   417 NGT----LDMPFLPTDQYRRQSLRTPLDVVVSMGGMLGLFLGASILSAIEFVYYFTVRPLSNML 476
            |.|    :.:...||.:|.|:..:|.||::|.:|.:.|||.|||:|:.:|.:.|| ::.|..|:
  Fly   361 NNTQITEIQIASPPTVRYERKVTQTKLDLIVGIGSVAGLFFGASLLNLLEIISYF-IKKLKTMI 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk15NP_001097937.1 ASC 27..466 CDD:279230 110/442 (25%)
ppk29NP_001097442.2 ASC 123..415 CDD:279230 87/322 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 1 1.000 - - FOG0014420
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.