DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk15 and F58G6.8

DIOPT Version :9

Sequence 1:NP_001097937.1 Gene:ppk15 / 43188 FlyBaseID:FBgn0039424 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001023246.2 Gene:F58G6.8 / 3565898 WormBaseID:WBGene00010278 Length:162 Species:Caenorhabditis elegans


Alignment Length:85 Identity:16/85 - (18%)
Similarity:36/85 - (42%) Gaps:3/85 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RGFGFVTNIKDYCTNCTLAGFAYIANSRLHFMERIFWLICVFMSSLGCYQLIMGYQRSFPTRAVS 80
            |...|..::|::....|:.|..::|.:.. .:..|.|.|.:.:|::....:......|:  .|.:
 Worm    49 RWIQFKNHLKNWGETATIHGVPHMAQAHT-VIAIIVWSIILIVSAVAFVYMFYSIAASY--LAFN 110

  Fly    81 IVYESLPPFSKWKFPAVSVC 100
            :|...........||:::.|
 Worm   111 VVVNLNTGLDSEPFPSITFC 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk15NP_001097937.1 ASC 27..466 CDD:279230 13/74 (18%)
F58G6.8NP_001023246.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.