DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk15 and ppk14

DIOPT Version :9

Sequence 1:NP_001097937.1 Gene:ppk15 / 43188 FlyBaseID:FBgn0039424 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_609017.2 Gene:ppk14 / 33887 FlyBaseID:FBgn0031803 Length:504 Species:Drosophila melanogaster


Alignment Length:531 Identity:116/531 - (21%)
Similarity:182/531 - (34%) Gaps:182/531 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TLAGFAYIANSRLH-----FME------RIFW---LICVFMSSLGCYQL-----IMG---YQRSF 74
            ||...:||:.|.:|     |:.      |:.|   |||      .|..|     ::|   :.:.|
  Fly    39 TLLIDSYISRSHIHGLYLLFLPSMRRRMRVLWALALIC------ACTVLFHVSYLLGDRYHNKQF 97

  Fly    75 PTRAVSIVYESLPPFSKWKFPAVSVC-----------ELAYRGNLFPK----FEEYITSLGVDVT 124
            .|    ||..:........||.|.:|           |:....|:.|.    |:..:|:      
  Fly    98 QT----IVAHAHASIHHIAFPVVIICNKNRLNWSRLPEIKSLYNITPSQDELFDRILTA------ 152

  Fly   125 GDYPYDVETGVSILLFPALYNENGLKGKC--GTVHKNCTDACAKCPSDNYRQILTWYGANCSDLF 187
                ||   |.|...|.|.   :.|.|:.  ...|.|.|:...:         ::|   .|.::.
  Fly   153 ----YD---GFSFHKFNAF---DSLLGESLDELNHLNFTEIVIQ---------MSW---RCDEIL 195

  Fly   188 VECKLSHEPFDCCRHFLPLLTPFGRCYMLNSL---------LN-------------NEPGSK--- 227
            .:|.......|||:.|.|...|.|.|...|.|         :|             :.||:.   
  Fly   196 RDCHWQTASRDCCKLFRPRRLPLGYCLAFNELEKRRGTETGINTGLLLRLLLREGQHAPGNSGLK 260

  Fly   228 -HWL-----------PNELDPAHQKAVINVITRLDVQISVINAEDIPHTAFFPPGIPLITEGLSK 280
             .||           |.|:.| |        :|.:|.::.:                        
  Fly   261 GFWLTVVESSVWFGFPIEVVP-H--------SRTNVAVTAV------------------------ 292

  Fly   281 YMQFNQVAMKNDPDVKDIDPKIRSCFFPEEIPADSLY----KSYSFSVCITECIRRLQMKACNCT 341
            |..|       |.....:....|.|....|..::...    :.|....|..||.:|..::.||||
  Fly   293 YHYF-------DESTLSLPSSWRHCVMDYEEESEHFRTLEGQKYMLENCQAECQQRYLLRYCNCT 350

  Fly   342 SFLYNPNADPRYPDCDLEGFLCLEKTRMI-----KPDSRVLVNNNKGNNASCGCLPSCNDGDITT 401
            ..|:.|.::  ||.|.|:...||.....:     :|.....|:..: :...|.||.:|....:.|
  Fly   351 VDLFYPPSN--YPACRLKDLPCLAAHNHLLQNFEQPGEHPYVHREE-SGLVCECLHNCKSLTLLT 412

  Fly   402 -----IYEPLLFVRNPNK------YYNGTLDMPFLPTDQYRRQSLRTPLDVVVSMGGMLGLFLGA 455
                 :.:|.|   .||.      :.|.....|.:..  |:...:.|.:|::||.||:..|.||.
  Fly   413 DMRKSVQQPWL---QPNSSAIESMWLNVYFKKPSMLV--YKTNLIYTWVDLIVSFGGICQLCLGC 472

  Fly   456 SILSAIEFVYY 466
            ||:|.||||::
  Fly   473 SIISLIEFVFF 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk15NP_001097937.1 ASC 27..466 CDD:279230 116/529 (22%)
ppk14NP_609017.2 ASC 45..483 CDD:279230 114/523 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.