DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk15 and Scnn1g

DIOPT Version :10

Sequence 1:NP_001097937.1 Gene:ppk15 / 43188 FlyBaseID:FBgn0039424 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_058742.2 Gene:Scnn1g / 24768 RGDID:3641 Length:650 Species:Rattus norvegicus


Alignment Length:595 Identity:122/595 - (20%)
Similarity:189/595 - (31%) Gaps:212/595 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IKD----YCTNCTLAGFAYIANSRLHFMERIFW----LICVFMSSLGCYQLIMGYQRSFPTRAVS 80
            |||    ||.|....|...|..||.. :.|:.|    |..|.:....|..|:.    ||.|.:||
  Rat    25 IKDLMHWYCMNTNTHGCRRIVVSRGR-LRRLLWIAFTLTAVALIIWQCALLVF----SFYTVSVS 84

  Fly    81 IVYESLPPFSKWKFPAVSVCELAYRGNLFPKFEEYITSLGVDVTGDYPYDVETGVSIL------- 138
            |...    |.|..||||::|      |:.|.....::.|..|:      |.||..::|       
  Rat    85 IKVH----FQKLDFPAVTIC------NINPYKYSAVSDLLTDL------DSETKQALLSLYGVKE 133

  Fly   139 -----------------------LFPAL-YNENGLKGKC-------------GTVHK-------- 158
                                   |.|.| :|||. |||.             ..:||        
  Rat   134 SRKRREAGSMPSTLEGTPPRFFKLIPLLVFNENE-KGKARDFFTGRKRKISGKIIHKASNVMHVH 197

  Fly   159 ------------NCTDACAKCP-SDNYRQILTWY-------------------GANCSDLFVECK 191
                        |.|..||... |.....|..||                   ..:..:|.|.|.
  Rat   198 ESKKLVGFQLCSNDTSDCATYTFSSGINAIQEWYKLHYMNIMAQVPLEKKINMSYSAKELLVTCF 262

  Fly   192 LSHEPFDCCRHFLPLLTP-FGRCYMLNS------LLNNEPGSKHWL-------PNELDP------ 236
            ......| .|:|.....| :|.||..|:      |..:..||::.|       .:|.:|      
  Rat   263 FDGMSCD-ARNFTLFHHPMYGNCYTFNNKENATILSTSMGGSEYGLQVILYINEDEYNPFLVSST 326

  Fly   237 -----AHQKAVINVITRLDVQISVINAEDIPHTAFFPPGIPLITEGLSKYMQFNQVAMKNDPDVK 296
                 .||:.....|..:.::|....:..|        |:.| ||.......::|.....     
  Rat   327 GAKVLIHQQNEYPFIEDVGMEIETAMSTSI--------GMHL-TESFKLSEPYSQCTEDG----- 377

  Fly   297 DIDPKIRSCFFPEEIPADSLYK-SYSFSVCITECIRRLQMKACNCTSF---------LYNPNADP 351
                        .::|..::|. :||..:|:..|.:...::.|.|..:         ..|....|
  Rat   378 ------------SDVPVTNIYNAAYSLQICLYSCFQTKMVEKCGCAQYSQPLPPAANYCNYQQHP 430

  Fly   352 RYPDCDLEGFLCLEKTRMIKPDSRVLVNNNKGNNASCGCLPSCNDGDITTIYEP---------LL 407
            .:..|..:.:             :..|....|..:.|....|..:..:||....         ||
  Rat   431 NWMYCYYQLY-------------QAFVREELGCQSVCKQSCSFKEWTLTTSLAQWPSEASEKWLL 482

  Fly   408 FV------RNPNKYYNGTLDMPFL---PTDQYRRQSLRTP---LDVVVS-MGGMLGLFLGASILS 459
            .|      :..||..|.| |:..|   ..|..:|..:.:|   :::::| .||.|||::..|::.
  Rat   483 NVLTWDQSQQINKKLNKT-DLAKLLIFYKDLNQRSIMESPANSIEMLLSNFGGQLGLWMSCSVVC 546

  Fly   460 AIEFVYYFTV 469
            .||.:..|.:
  Rat   547 VIEIIEVFFI 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk15NP_001097937.1 ASC 27..466 CDD:459966 118/583 (20%)
Scnn1gNP_058742.2 ENaC 24..631 CDD:273304 122/595 (21%)
Gating release of inhibition by proteolysis (GRIP), protease-sensitive region that is responsible for the proteolytic activation of the channel. /evidence=ECO:0000250|UniProtKB:P51170 135..222 15/87 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 577..628
PY motif, mediates interaction, ubiquitination and inhibition by NEDD4 and NEDD4L. /evidence=ECO:0000269|PubMed:12654927 624..628
PY motif, recruits WW domain-containing proteins and is thereby required for ubiquitination and inhibition of the channel by NEDD4 and NEDD4L. /evidence=ECO:0000250|UniProtKB:P51170 624..628
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.