DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk15 and egas-3

DIOPT Version :9

Sequence 1:NP_001097937.1 Gene:ppk15 / 43188 FlyBaseID:FBgn0039424 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_507638.2 Gene:egas-3 / 190557 WormBaseID:WBGene00013480 Length:921 Species:Caenorhabditis elegans


Alignment Length:344 Identity:71/344 - (20%)
Similarity:120/344 - (34%) Gaps:89/344 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 SDNYRQILTWYGANCSDLFVECKLSHEPFDCCRHF-----LPLLTPFGRCYMLN------SLLNN 222
            :|:.|..|:|   :..|||.......:..|..|..     :.|    |.|:..|      :.|..
 Worm   609 TDSERSDLSW---DAGDLFNWIAFEDQRLDLNRDIHKWNDVVL----GNCFTFNHRDRNFTYLMR 666

  Fly   223 EPGSKHWL-------PNELDPAHQKAVINVI--TRLDVQISVINAEDIPHTAFFPPGIPLITEGL 278
            .||....:       .:|..|.:..|.|||.  .|.|...|    |.:.:.| .|.....|...:
 Worm   667 RPGRHGGIQAFMKTRQDEYAPWYDTAAINVFIHNRDDYVFS----ESVRYNA-QPNAQSTINIFM 726

  Fly   279 SKYMQFN---QVAMKNDPDVKDIDPKIRSCFFPEEIPADSLYKSYSFSVCITECIRRLQMKACNC 340
            ::|.:..   ...:|...:||:.       ::|         .:|:...|:..|.:....:.|||
 Worm   727 TRYTRLGGNYGKCIKKPSEVKNY-------YYP---------GAYTTDGCLRTCYQDRMKEECNC 775

  Fly   341 TSFLYNPNADPRYP------DCDLEGFLCLEKTRMIKPDSRVLVNNNKGNNASCGCLPSCNDGDI 399
                    .|||||      .|.|....|:.:......|....        :||.|...|::.:.
 Worm   776 --------MDPRYPQAPNSTSCQLSERSCVTEASEAAGDPSTW--------SSCVCPLPCSNQEY 824

  Fly   400 TTIYEPLLFVRNP------------NKYYNGTLDMP-FLPTDQYRRQSLRTPLD---VVVSMGGM 448
            :..:....||..|            .|.|...|.:. .||...::..:....:|   .:..:||.
 Worm   825 SVTWSKANFVNLPITCEKSSDVATCQKQYKDQLMVSIILPQLDFKIYAETPAMDFNKFLSQLGGQ 889

  Fly   449 LGLFLGASILSAIEFVYYF 467
            ||:.:|.::::.||.|:.|
 Worm   890 LGVLMGINVVTFIEVVFLF 908

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk15NP_001097937.1 ASC 27..466 CDD:279230 70/341 (21%)
egas-3NP_507638.2 ASC <649..907 CDD:279230 60/294 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.