DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk15 and del-5

DIOPT Version :9

Sequence 1:NP_001097937.1 Gene:ppk15 / 43188 FlyBaseID:FBgn0039424 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_509838.2 Gene:del-5 / 186631 WormBaseID:WBGene00010334 Length:526 Species:Caenorhabditis elegans


Alignment Length:355 Identity:66/355 - (18%)
Similarity:116/355 - (32%) Gaps:125/355 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 DACAKCPSDNYRQILTWYG-------ANCSDLFVECKLSHEPFDCCRHFLPLLTPFGRCYMLNSL 219
            |.|     |.|..:.|::|       .||..|...|.:    ...|..|..::     |..:...
 Worm    61 DGC-----DEYTNLTTFHGMIRVFNSRNCPSLIFWCLV----VTTCLVFYIMV-----CGTMIKT 111

  Fly   220 LNNEPGSKHWLPNELDPAHQKAVINVITRLDVQISVINAEDIPHTAFFPPGIPLITEGLSKYMQF 284
            .:.:|....                           || |...|.|  ...|.|.:|   |.:..
 Worm   112 YSTQPSFMR---------------------------IN-ETKSHRA--ENNIELCSE---KQLTC 143

  Fly   285 NQVAMKN-DPDVKDID-----------PKIR----SCFFPEEIPADSLY---KSYSFSVCITECI 330
            |::..:| ....|::|           .|||    ..:|......|..|   |.::..:...:.|
 Worm   144 NEILKENKQMTCKEVDAYCVSIRFSTKTKIRLKKKGLYFKHGTEEDVHYLSSKPHTHHMIRLKLI 208

  Fly   331 R--RLQMKACNCTS---------------FLYNPNADPRYPDCDLEGFLCLEKTRMIKPDSRVLV 378
            :  ||.:....||:               :.|:.|.      |:...|....|...::.|     
 Worm   209 QIDRLNLGRAPCTTNWREITWIEKDSIPDYRYSLNM------CENIRFELTRKVEYLQYD----- 262

  Fly   379 NNNKGNNASCGCLPSCNDGDITTIYEPLLFVRNPNKYYNGT----LDMPFLPTDQYRRQSLRTPL 439
                     ..|.|||::         :.:..:.:|..:.:    :....|||....:::.:|.|
 Worm   263 ---------FPCYPSCSE---------IKYQVSKSKLRHSSDSVVITFSVLPTITLMQETRKTTL 309

  Fly   440 -DVVVSMGGMLGLFLGASILSAIE-FVYYF 467
             |::..:||...||:|.|.::.:| ||:.|
 Worm   310 IDILCYLGGASSLFMGCSCVTLMEMFVFLF 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk15NP_001097937.1 ASC 27..466 CDD:279230 65/352 (18%)
del-5NP_509838.2 ASC 66..337 CDD:295594 61/341 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.