DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk15 and degt-1

DIOPT Version :9

Sequence 1:NP_001097937.1 Gene:ppk15 / 43188 FlyBaseID:FBgn0039424 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_505703.3 Gene:degt-1 / 184921 WormBaseID:WBGene00009109 Length:852 Species:Caenorhabditis elegans


Alignment Length:453 Identity:86/453 - (18%)
Similarity:157/453 - (34%) Gaps:152/453 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FVTNIKDYCTNCTLAGFAYIANSRLHFMERIFW-LICVFMSSLGCYQL---IMGY--QRSFPTRA 78
            ::..:..:..:.::.||.|: ::|.....|:.| .:.||...|..||:   :..|  :....||.
 Worm    37 YIPALDRFAEDTSMLGFRYL-HTRYKTWFRVLWGFVVVFFIGLTFYQVFERVTYYFIKNPLTTRR 100

  Fly    79 VSIVYESLPPFSKWKFPAVSVCELAYRGNLFPKFEEYITSLGVDVTGDYPYDVETGVSILLFPAL 143
               .||:||   ...||.:.||.         |.:...:|:                      |.
 Worm   101 ---SYETLP---NMYFPTIGVCN---------KMQIKASSV----------------------AS 128

  Fly   144 YNENGLKGKCGTVHKNCTDACAKCPSDNYR--QILTWYG---ANCSDLFVECKLSHEPFDCCRHF 203
            .|.:.|:|.|..:.::.:::......|.:.  .||:.|.   .:..||||.|:.. :...|....
 Worm   129 KNPDLLRGMCSVLDESSSNSSRFDELDKFDDVDILSLYRNSFQSADDLFVSCEFG-KSGSCQDEI 192

  Fly   204 LPLLTPFGRCYMLNSLLNNEPGSKHWLPNE--LDPAHQKAVINVITRLDVQISVINAEDIPHTAF 266
            .|:.||||.||.::             ||:  |.|. .:..::::..|:|.      |.||.|..
 Worm   193 RPIYTPFGLCYSVS-------------PNKTILRPG-PETTLSLVLNLEVH------EIIPGTVV 237

  Fly   267 FPPGIPLITEGLSKYMQFNQ-VAMKNDPDVKDIDPKIRSCFFPEEIPADSLYKSYSFSVCITECI 330
            .|..:..|.:|.|....::: :.::....|              .||.:.              :
 Worm   238 EPGVVLSIYDGASSLSHYSEGIHLEAGKVV--------------TIPVNE--------------V 274

  Fly   331 RRLQMKACNCTSFLYNPNADPRYPDCDLEGFLCLEKTRMIKPDSRVLVNNNKGNNASCGCLPSCN 395
            |:|::...:|.|......::..|.....|..:.:::.                 ...|||:|   
 Worm   275 RKLRLHESSCGSTKMESFSEKEYSKAACEWSVSVKQI-----------------EKECGCIP--- 319

  Fly   396 DGDITTIYEPLLFVRNPNKYYNGTLDM---PF-----LPTDQYR--------RQSLRTPLDVV 442
                         :|||  .|.|..|.   |.     :|..:|:        |.:||..::.|
 Worm   320 -------------IRNP--IYRGVFDNKNDPLNNSTEIPKKKYKKWKKRNIPRCTLRQEIECV 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk15NP_001097937.1 ASC 27..466 CDD:279230 86/446 (19%)
degt-1NP_505703.3 ASC 44..>318 CDD:279230 71/377 (19%)
ASC <704..836 CDD:295594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.