DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk15 and mec-4

DIOPT Version :9

Sequence 1:NP_001097937.1 Gene:ppk15 / 43188 FlyBaseID:FBgn0039424 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_510712.2 Gene:mec-4 / 181728 WormBaseID:WBGene00003168 Length:768 Species:Caenorhabditis elegans


Alignment Length:337 Identity:75/337 - (22%)
Similarity:126/337 - (37%) Gaps:98/337 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 DLFVECKLSHEPFDCCRHFLPLLTP-FGRCYMLN-----SLLNNEPGSKHWLPNELDPAHQKAVI 243
            :|..:|..:.:..|....||..:.| ||.|:..|     :|.:...|          |.:...::
 Worm   445 ELVHKCSFNGKACDIEADFLTHIDPAFGSCFTFNHNRTVNLTSIRAG----------PMYGLRML 499

  Fly   244 NVITRLD---------VQISVINAEDIPHTAFFPPGIPLITEGLSKY-MQFNQVAMKNDPDVKDI 298
            ..:...|         |::::.:.||.|....|....|  |..:|.: ::..:::....|     
 Worm   500 VYVNASDYMPTTEATGVRLTIHDKEDFPFPDTFGYSAP--TGYVSSFGLRLRKMSRLPAP----- 557

  Fly   299 DPKIRSCFFPEEIPADSLYKSYSFSV--CITECIRRLQMKACNCTSFLYNPNADPRYP------D 355
               ...| .|:...:|.:|.:|.:||  |...|.::|.:|.|.|        .|||:|      .
 Worm   558 ---YGDC-VPDGKTSDYIYSNYEYSVEGCYRSCFQQLVLKECRC--------GDPRFPVPENARH 610

  Fly   356 CDLEGFL---CLEKTRMIKPDSRVLVNNNKGNNAS--CGCLPSCNDGDITTIYEPLLFVRNP--- 412
            ||....:   ||        |:|  :|:..|.:.|  |.|...|.....:..|.|   .:.|   
 Worm   611 CDAADPIARKCL--------DAR--MNDLGGLHGSFRCRCQQPCRQSIYSVTYSP---AKWPSLS 662

  Fly   413 ---------------NKYY--NGTLDMPFLPTDQYRRQSLRTP-----LDVVVSMGGMLGLFLGA 455
                           ||:|  ||.:...|.  :|...:.|...     ::::...||.|||:.|.
 Worm   663 LQIQLGSCNGTAVECNKHYKENGAMVEVFY--EQLNFEMLTESEAYGFVNLLADFGGQLGLWCGI 725

  Fly   456 SILSAIEFVYYF 467
            |.|:..|||:.|
 Worm   726 SFLTCCEFVFLF 737

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk15NP_001097937.1 ASC 27..466 CDD:279230 74/334 (22%)
mec-4NP_510712.2 deg-1 86..736 CDD:273309 74/334 (22%)
ASC 87..>172 CDD:279230
ASC <428..739 CDD:295594 75/337 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.