DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk15 and mec-10

DIOPT Version :9

Sequence 1:NP_001097937.1 Gene:ppk15 / 43188 FlyBaseID:FBgn0039424 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_509438.1 Gene:mec-10 / 181101 WormBaseID:WBGene00003174 Length:724 Species:Caenorhabditis elegans


Alignment Length:339 Identity:71/339 - (20%)
Similarity:123/339 - (36%) Gaps:108/339 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 DLFVECKLSHEPFDCCRHFLPLLTP-FGRCYMLN-------SLLNNEP----------GSKHWLP 231
            :|..:|..:.:|.|..:.|..:..| ||.|::.|       |.:...|          .:..:||
 Worm   405 NLIHKCSFNGKPCDIDQDFELVADPTFGNCFVFNHDREIFKSSVRAGPQYGLRVMLFVNASDYLP 469

  Fly   232 NELDPAHQKAVINVITRLDVQISVINAEDIPHTAFFPPGIPLITEGLSKY-MQFNQVAMKNDPDV 295
            .      .:||       .:::::.:.:|.|....|....|  |..:|.: |:..:::....|..
 Worm   470 T------SEAV-------GIRLTIHDKDDFPFPDTFGYSAP--TGYISSFGMRMKKMSRLPAPYG 519

  Fly   296 KDIDPKIRSCFFPEEIPADSLYKSYSFSV--CITECIRRLQMKACNCTSFLYNPNADPRYPD--- 355
            ..::....|.:         :||.|::|.  |...|.:.|.:..|.|        :|||:|.   
 Worm   520 DCVEDGATSNY---------IYKGYAYSTEGCYRTCFQELIIDRCGC--------SDPRFPSIGG 567

  Fly   356 ---CDL------EGFLCLEK-TRMIKPDSRVLVNNNKGNNASCGCLPSCNDGDITTIYEPLLFVR 410
               |.:      |   |||| |..|         .....:..|.|...||....||.|...::  
 Worm   568 VQPCQVFNKNHRE---CLEKHTHQI---------GEIHGSFKCRCQQPCNQTIYTTSYSEAIW-- 618

  Fly   411 NPNKYYNGTLDMPFLP----TDQYRRQSLRTPLDV-----------------VVSM----GGMLG 450
             |::..|.:|......    .::|:..:  ..|:|                 :|.|    ||.||
 Worm   619 -PSQALNISLGQCEKEAEECNEEYKENA--AMLEVFYEALNFEVLSESEAYGIVKMMADFGGHLG 680

  Fly   451 LFLGASILSAIEFV 464
            |:.|.|:::..|||
 Worm   681 LWSGVSVMTCCEFV 694

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk15NP_001097937.1 ASC 27..466 CDD:279230 71/339 (21%)
mec-10NP_509438.1 ASC 88..723 CDD:295594 71/339 (21%)
deg-1 99..696 CDD:273309 71/339 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.