DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk15 and del-6

DIOPT Version :9

Sequence 1:NP_001097937.1 Gene:ppk15 / 43188 FlyBaseID:FBgn0039424 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_741622.2 Gene:del-6 / 179474 WormBaseID:WBGene00011891 Length:577 Species:Caenorhabditis elegans


Alignment Length:482 Identity:89/482 - (18%)
Similarity:151/482 - (31%) Gaps:199/482 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 FMSSLGCYQLIM-------------------GYQRSFPTRAVSIVYESLPPFSKWKFPAVSVCEL 102
            ||.:...|:|:|                   |..||..      |:::.|             .|
 Worm   130 FMKTPWDYRLVMEAYDMIATYSSLERETTAHGSARSIH------VFKNAP-------------RL 175

  Fly   103 AYRGNLFPKFEEYITSLGVDVTGDYPYDVETGVSIL----------LFPALYNENGLKGKCGTVH 157
            |.:...|.|:.:.:.|.|  :|.| .:..:||:.:|          .|..  :|..:|.|.....
 Worm   176 AAKRKTFKKWRDILDSRG--ITFD-EFTQKTGIEVLRRSMQRFRRRTFDD--DETVIKTKLRISW 235

  Fly   158 KNCTDAC--AKCPSDNYRQILTWYGANCSDLFVECKLSH-------EPFDCCRHFLPLLTPF-GR 212
            .:....|  .:...||::.|      :...:|.:..|||       :..||      :...| ||
 Worm   236 ISQMQICFQPEFDQDNFKTI------DDQGVFFDMLLSHNAENTEGQKIDC------MSVDFHGR 288

  Fly   213 CYMLNSLLNNEPGSKHWLPNELDPAHQKAVINVITRLDVQISVINAEDIPHTAFFPPGIPLITEG 277
            ...||..:..:..|:....:|:....:..|...:|.|                            
 Worm   289 PSSLNRFMEGKGRSRDGYVDEVCLGQRHEVTAHVTAL---------------------------- 325

  Fly   278 LSKYMQFNQVAMKNDP------DVKDIDPKIRSCFFPEEIPADSLYKSYSFSVCITECIRRLQMK 336
               |..     ::||.      ||:|.:              ||.:.      |.:.|...:...
 Worm   326 ---YQM-----LENDEQGTRCRDVEDGE--------------DSEFN------CRSRCRMEMIRD 362

  Fly   337 ACNCT----SFLYNPNADPRYPDCDLEGFLCLEKTRMIKPDSRVLVNNNKGN--NASCG--CLPS 393
            ||:||    |:|........:|.||.               ::..|:..|||  :..|.  |.|.
 Worm   363 ACHCTPLSLSYLAKKEDMEIFPLCDY---------------TQCTVDVQKGNYSDTECANKCFPD 412

  Fly   394 CND---------------GDITTI---YEPLLFVRNPNKY-YNGTLDMPFLPTDQYRRQSLRTPL 439
            |..               .|:|.:   :.|..::....:: |:.|                    
 Worm   413 CRQIRFEVDHSVKGRMLRPDLTLVELSWGPFEYLTMEQQWKYSAT-------------------- 457

  Fly   440 DVVVSMGGMLGLFLGASILSAIEFVYY 466
            ..:.::||.:|::||.||||.|:.|.|
 Worm   458 SFIAALGGSIGMWLGLSILSLIQLVTY 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk15NP_001097937.1 ASC 27..466 CDD:279230 88/480 (18%)
del-6NP_741622.2 ASC <347..484 CDD:295594 36/177 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.