DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk15 and del-10

DIOPT Version :9

Sequence 1:NP_001097937.1 Gene:ppk15 / 43188 FlyBaseID:FBgn0039424 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_495302.3 Gene:del-10 / 174069 WormBaseID:WBGene00020897 Length:1069 Species:Caenorhabditis elegans


Alignment Length:381 Identity:80/381 - (20%)
Similarity:135/381 - (35%) Gaps:103/381 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VFMSSLGCYQLIMGYQRSFPTRAVSIVYESLPPFSKWKFPAVSVC-----ELAY--RGNLFPKFE 113
            |.:..:.||..|    :.:.:..|:...|:..| ||..||.|::|     .|.|  .|.:..:..
 Worm   105 VILVLVQCYSQI----KLYISEPVATNIEAEYP-SKISFPTVAICNNNQFRLTYLTGGRIMNRRS 164

  Fly   114 EYITSLGVDVTGDYPYDVETGVSILLFPALYNENGLKGKCGTVHKNCTDACAKCPSDNYRQIL-- 176
            :.|:. .:..||   :|||:....:|..: ::.:.:|......|...            |.||  
 Worm   165 KSISG-SLLSTG---HDVESVFDTVLRKS-WDMDAVKFLRSAAHWKS------------RMILGC 212

  Fly   177 TWYGANCSDLFVECKLSHEPFDCCRHFLPLLTPFGRCYMLNSLLNNE-----PGSKHWLPNELDP 236
            ||...      ..||||        .|..:.|..|.|:.:|:..:|.     .|..|.|      
 Worm   213 TWPNG------TSCKLS--------DFKAVWTTTGLCWAINTDPHNPYEVTGSGEGHGL------ 257

  Fly   237 AHQKAVINV--ITRLD-------------VQISVINAEDIPHTAFFPPGIPLITEGLSKYMQFNQ 286
               :.::||  ..|:|             ::|.:.|..|||.::.....:|   .|.|..:.|..
 Worm   258 ---RLLLNVESYERVDACTKHFRTKTLPGLKILIYNQTDIPDSSMNGVNVP---SGYSMDIPFKM 316

  Fly   287 VAMKNDPDVKDIDPKIRSCFFPEEIPADSLYKSYSFSVCITECIRRLQM----KACNCT-SFLYN 346
            ........|..|:..      .|:|.|.:   .::....|..|..|..|    .:|:|| ...|.
 Worm   317 QHRSKLTGVHCIEEN------DEQIEAST---DFNNPENIRTCTLRRYMTEVENSCHCTLRRAYT 372

  Fly   347 PNA-DPRYPDCDLEGFL-CLEKTRMIKPDSRVLVNNNKGNNASCGCLPSCNDGDIT 400
            .|: |.:...|:::.:. |.:|.          :...:....:..|||.|...|.|
 Worm   373 SNSTDVKMKACNVDQYFGCAQKA----------MQRIREEGTASTCLPPCKSIDYT 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk15NP_001097937.1 ASC 27..466 CDD:279230 80/381 (21%)
del-10NP_495302.3 ASC 83..>419 CDD:279230 80/381 (21%)
ASC <789..849 CDD:279230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.