DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk15 and asic2

DIOPT Version :9

Sequence 1:NP_001097937.1 Gene:ppk15 / 43188 FlyBaseID:FBgn0039424 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_004918663.1 Gene:asic2 / 100492214 XenbaseID:XB-GENE-6033380 Length:541 Species:Xenopus tropicalis


Alignment Length:525 Identity:116/525 - (22%)
Similarity:187/525 - (35%) Gaps:158/525 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LAGFAYIANSRLHFMERIFWLICVFMSSLGCY------QLIMGYQRSFPTRA-VSIVYESLPPFS 90
            |.|..||.:.:|.|..|.||.: .|.:|||.:      :|:  |..|||:.. |.:         
 Frog    50 LHGLKYICSPKLAFRHRTFWFL-AFFTSLGFFLSWSSNRLL--YWLSFPSHTRVQL--------- 102

  Fly    91 KWK----FPAVSVC-ELAYRGNLFPKFEEYITS--LGVDVTGDYPYDVETGVSILLF-------- 140
            :|.    ||||:.| ....|.:...|.:.|...  ||                 |||        
 Frog   103 EWSKELAFPAVTFCNNNPVRFHRLSKSDLYFAGYWLG-----------------LLFANRTARPM 150

  Fly   141 -PALYNENGLKGKCGTVHKNCTDACAKCPSDNYRQILTWY----GANCSDLFVECKLSHEPFDCC 200
             ..|..|:..|.     .:...|.....|..|:..|...:    |....|:.:.||...|.  |.
 Frog   151 LAELLPEDRRKW-----FQKLADFRLFLPPRNFDGISVGFMDRLGHQLEDMLLSCKYRGEA--CG 208

  Fly   201 RH-FLPLLTPFGRCYMLNSLLNNEPGSKHWLPNELDPAHQKAVINVI-----TRLDVQISVINAE 259
            .| |..:.|.:|:|||.||..:..|                 |:..:     ..|::.:.:...|
 Frog   209 PHNFSTVFTRYGKCYMFNSGQDGRP-----------------VLTTVKGGAGNGLEIMLDIQQDE 256

  Fly   260 DIP------------------HTAFFPPGIPLITEGLSKYMQFNQVAMKNDPDVKDIDPKIRSCF 306
            .:|                  |:...||.|..:..|::.  .|.......:..:..:.....:|.
 Frog   257 YLPIWGDTEETTFEAGVKVQIHSQSEPPFIQELGFGVAP--GFQTFVATQEQRLTYLPSPWGACR 319

  Fly   307 FPEEIPADSLYKSYSFSVCITECIRRLQMKACNCTSFLYNPNADP-----RYPDCDLEGFLCLEK 366
            | .|:.:| .:..||.|.|..:|..|..::.|.| ..::.|...|     :|.:|          
 Frog   320 F-SELGSD-FFPVYSISACRIDCETRYIVENCGC-KMVHMPGDAPFCTPEQYKEC---------- 371

  Fly   367 TRMIKPDSRVLVNNNKGNNASCGCLPSCNDGDITTIYEPLLFVRNPNKYYNGTLDMPFLPTDQYR 431
               .:|...:|...:.||   |.|...||   :|...:.|..|:.|:|.....|:..|..:::|.
 Frog   372 ---AEPALDLLAEKDGGN---CVCTIPCN---VTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYI 427

  Fly   432 RQSLRTPLDV---------------------VVSMGGMLGLFLGASILSAIE---FVYYFTVRPL 472
            ..::.. |||                     :..:||.:|||:|||||:.:|   ::|......|
 Frog   428 LDNILV-LDVFFEALNYETIEQRKAYEVAGLLGDIGGQMGLFIGASILTILELFDYIYELIKEKL 491

  Fly   473 SNMLG 477
            .::||
 Frog   492 LDLLG 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk15NP_001097937.1 ASC 27..466 CDD:279230 112/512 (22%)
asic2XP_004918663.1 ASC 49..497 CDD:383197 116/525 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.