DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33970 and ABCB13

DIOPT Version :9

Sequence 1:NP_001034071.1 Gene:CG33970 / 43186 FlyBaseID:FBgn0053970 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_174115.1 Gene:ABCB13 / 839687 AraportID:AT1G27940 Length:1245 Species:Arabidopsis thaliana


Alignment Length:217 Identity:57/217 - (26%)
Similarity:105/217 - (48%) Gaps:35/217 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 PNVVLDGLNMTVPKGSIYGLLGASGCGKTTLLSCIVGRRRLNSGEIWVLGGRPGSRGSGVPGPRI 127
            ||:|.:.|:.|:..|..:..:|.||.||:|::|.:......|||||.:.|....|........::
plant   385 PNMVFENLSFTIRSGKTFAFVGPSGSGKSTIISMVQRFYEPNSGEILLDGNDIKSLKLKWFREQL 449

  Fly   128 GYMPQEIALYGEFTMRETLIYFGIISAMSKGDIEDRTEFLLKLLNLPNASKFVKN---------- 182
            |.:.||.||:.      |.|...|:......:::.    :::.....||..|:|:          
plant   450 GLVSQEPALFA------TTIASNILLGKENANMDQ----IIEAAKAANADSFIKSLPNGYNTQVG 504

  Fly   183 -----LSGGQQRRVSLAVALLHEPELLILDEPTVGVD----PVLRQSIWDHLVDITKNGHTTVII 238
                 |||||::|:::|.|:|..|::|:|||.|..:|    .:::|:: |::::     ..|.|:
plant   505 EGGTQLSGGQKQRIAIARAVLRNPKILLLDEATSALDAESEKIVQQAL-DNVME-----KRTTIV 563

  Fly   239 TTHYIDECAQAHMIGLLRGGKM 260
            ..|.:........|.:||.|::
plant   564 VAHRLSTIRNVDKIVVLRDGQV 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33970NP_001034071.1 P-loop_NTPase 48..270 CDD:304359 57/217 (26%)
CcmA 54..321 CDD:224054 57/217 (26%)
ABC2_membrane_3 394..770 CDD:289468
ABC2_membrane <581..738 CDD:279410
ABCB13NP_174115.1 PTZ00265 54..1241 CDD:240339 57/217 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.