DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33970 and ABCI19

DIOPT Version :9

Sequence 1:NP_001034071.1 Gene:CG33970 / 43186 FlyBaseID:FBgn0053970 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_563694.1 Gene:ABCI19 / 839376 AraportID:AT1G03905 Length:290 Species:Arabidopsis thaliana


Alignment Length:257 Identity:70/257 - (27%)
Similarity:116/257 - (45%) Gaps:49/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 NMTVPKGSIYGLLGASGCGKTTLLSCIVGRRRLN--------------------SGEIWVLGGRP 115
            |:.:|.||...|:||:|.||||||..:.|:..:.                    ||::..||| .
plant    34 NLDLPAGSRCLLVGANGSGKTTLLKILAGKHMVGGKNVVQVLSRSAFHDTQLVCSGDLSYLGG-S 97

  Fly   116 GSRGSGVPGPRIGYMPQEIALYGEFTMRETLIYFGIISAMSKGDIEDRTEFLLKLLNLPNASKFV 180
            .|:..|..|        |:.|.|:|:....:  ||:     :|....|.|.|:.||:: |....:
plant    98 WSKTVGSAG--------EVPLQGDFSAEHMI--FGV-----EGTDPVRREKLIDLLDI-NLQWRM 146

  Fly   181 KNLSGGQQRRVSLAVALLHEPELLILDEPTVGVDPVLRQSIWDHLVDITKNGHTTVIITTHYID- 244
            ..:|.||:|||.:.:.|||..::|:|||.||.:|.|.|..:.:...:.......|::..||..| 
plant   147 HKVSDGQKRRVQICMGLLHPFKVLLLDEVTVDLDVVARMDLLEFFKEECDQRGATIVYATHIFDG 211

  Fly   245 -ECAQAHMIGLLRG-----GKMLAEESPDYLRQQYNADSLEDVFLKLSVLQNMGKRRRSSIA 300
             |....|:..:..|     .||...|.   |:...|..|:.:.:|:..:  .:.|:::..:|
plant   212 LETWATHLAYIQDGELNRLSKMTDIEE---LKTSPNLLSVVESWLRSEI--KLVKKKKKPVA 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33970NP_001034071.1 P-loop_NTPase 48..270 CDD:304359 64/225 (28%)
CcmA 54..321 CDD:224054 70/257 (27%)
ABC2_membrane_3 394..770 CDD:289468
ABC2_membrane <581..738 CDD:279410
ABCI19NP_563694.1 COG4586 32..>227 CDD:226952 61/209 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.