DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33970 and ABCB11

DIOPT Version :9

Sequence 1:NP_001034071.1 Gene:CG33970 / 43186 FlyBaseID:FBgn0053970 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_001322407.1 Gene:ABCB11 / 839353 AraportID:AT1G02520 Length:1278 Species:Arabidopsis thaliana


Alignment Length:353 Identity:89/353 - (25%)
Similarity:150/353 - (42%) Gaps:97/353 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VLDGLNMTVPKGSIYGLLGASGCGKTTLLSCIVGRRRLNSGEI-------------WVLGGRPGS 117
            :.||.::.:|.|:...|:|.||.||:|::|.|.......||.:             |:..     
plant   398 IFDGFSLFIPSGATAALVGESGSGKSTVISLIERFYDPKSGAVLIDGVNLKEFQLKWIRS----- 457

  Fly   118 RGSGVPGPRIGYMPQEIALYGEFTMRETLIYFGIISAMSKGDIEDRTEFLLKLLNLPNASKFV-- 180
                    :||.:.||..|:....|..  |.:|..:|..: :|:..||       |.||:||:  
plant   458 --------KIGLVSQEPVLFSSSIMEN--IAYGKENATVE-EIKAATE-------LANAAKFIDK 504

  Fly   181 -------------KNLSGGQQRRVSLAVALLHEPELLILDEPTVGVDPVLRQSIWDHLVDITKNG 232
                         ..|||||::|:::|.|:|.:|.:|:|||.|..:|....:.:.:.|..:..| 
plant   505 LPQGLDTMVGEHGTQLSGGQKQRIAIARAILKDPRILLLDEATSALDAESERVVQEALDRVMVN- 568

  Fly   233 HTTVIITTHYIDECAQAHMIGLLRGGKMLAEESPDYL-------------RQQYNADSLEDVFLK 284
            .||||: .|.:.....|.||.::..|||:.:.|...|             .|:.|.|      :|
plant   569 RTTVIV-AHRLSTVRNADMIAVIHRGKMVEKGSHSELLKDSEGAYSQLIRLQEINKD------VK 626

  Fly   285 LSVLQNMGKRRRSSIAQEIVEQVTVPAISNPALDMSDEQHAAEISG-----EFGDNISMS----- 339
            .|.|.: |...|:|..::.:|..:  ::.|     |...|:..:.|     :.|.:...:     
plant   627 TSELSS-GSSFRNSNLKKSMEGTS--SVGN-----SSRHHSLNVLGLTTGLDLGSHSQRAGQDET 683

  Fly   340 -SAARDP---ISTTAPAAPPLPPPQEIP 363
             :|:::|   :|.|..||...|   |||
plant   684 GTASQEPLPKVSLTRIAALNKP---EIP 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33970NP_001034071.1 P-loop_NTPase 48..270 CDD:304359 64/244 (26%)
CcmA 54..321 CDD:224054 75/295 (25%)
ABC2_membrane_3 394..770 CDD:289468
ABC2_membrane <581..738 CDD:279410
ABCB11NP_001322407.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.