DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33970 and ABCB5

DIOPT Version :9

Sequence 1:NP_001034071.1 Gene:CG33970 / 43186 FlyBaseID:FBgn0053970 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_192092.1 Gene:ABCB5 / 826974 AraportID:AT4G01830 Length:1230 Species:Arabidopsis thaliana


Alignment Length:334 Identity:86/334 - (25%)
Similarity:139/334 - (41%) Gaps:78/334 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VLDGLNMTVPKGSIYGLLGASGCGKTTLLSCIVGRRRLNSGEI-------------WVLGGRPGS 117
            |..|.::.:|.|:...|:|.||.||:|::|.|......|||::             |:.|     
plant   370 VFGGFSLLIPSGTTTALVGESGSGKSTVISLIERFYDPNSGQVLIDGVDLKEFQLKWIRG----- 429

  Fly   118 RGSGVPGPRIGYMPQEIALYGEFTMRETLIYFG-------IISAMSKGDIEDRTEFLLKLLNLPN 175
                    :||.:.||..|:....|..  |.:|       .|.|.||               |.|
plant   430 --------KIGLVSQEPVLFSSSIMEN--IGYGKEGATVEEIQAASK---------------LAN 469

  Fly   176 ASKFV---------------KNLSGGQQRRVSLAVALLHEPELLILDEPTVGVDPVLRQSIWDHL 225
            |:||:               ..|||||::|:::|.|:|.:|.:|:|||.|..:|....:.:.:.|
plant   470 AAKFIDKLPLGLETLVGEHGTQLSGGQKQRIAIARAILKDPRILLLDEATSALDAESERVVQEAL 534

  Fly   226 VDITKNGHTTVIITTHYIDECAQAHMIGLLRGGKMLAEESPDYLRQQYNADSLEDVFLKLSVLQN 290
            ..|..| .||||: .|.:.....|.:|.::..||::.|.|...|.:.:     |..:.:|..||.
plant   535 DRIMVN-RTTVIV-AHRLSTVRNADIIAVIHRGKIVEEGSHSELLKDH-----EGAYSQLLRLQE 592

  Fly   291 MGKR-RRSSIAQEIVEQVTVPAISNPALDMSDEQHAAEISGEFGDNISMSSAARDPISTTAPAAP 354
            :.|. :|..|:...:...:....::...|.........::|:  |:..||......:|.|..||.
plant   593 INKESKRLEISDGSISSGSSRGNNSTRQDDDSFSVLGLLAGQ--DSTKMSQELSQKVSFTRIAAL 655

  Fly   355 PLPPPQEIP 363
            ..|   |||
plant   656 NKP---EIP 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33970NP_001034071.1 P-loop_NTPase 48..270 CDD:304359 65/238 (27%)
CcmA 54..321 CDD:224054 74/290 (26%)
ABC2_membrane_3 394..770 CDD:289468
ABC2_membrane <581..738 CDD:279410
ABCB5NP_192092.1 PTZ00265 2..1224 CDD:240339 86/334 (26%)
ABC_membrane 35..293 CDD:279056
ABC_MTABC3_MDL1_MDL2 353..591 CDD:213216 68/257 (26%)
ABC_membrane 667..936 CDD:279056
ABC_MTABC3_MDL1_MDL2 985..1224 CDD:213216
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.