DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33970 and ABCB21

DIOPT Version :9

Sequence 1:NP_001034071.1 Gene:CG33970 / 43186 FlyBaseID:FBgn0053970 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_001327192.1 Gene:ABCB21 / 825388 AraportID:AT3G62150 Length:1296 Species:Arabidopsis thaliana


Alignment Length:380 Identity:90/380 - (23%)
Similarity:162/380 - (42%) Gaps:81/380 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VLDGLNMTVPKGSIYGLLGASGCGKTTLLSCIVGRRRLNSGEI-------------WVLGGRPGS 117
            :..|.::::..||...|:|.||.||:|::|.|.......|||:             |:..     
plant   420 IFRGFSLSISSGSTVALVGQSGSGKSTVVSLIERFYDPQSGEVRIDGINLKEFQLKWIRS----- 479

  Fly   118 RGSGVPGPRIGYMPQEIALYGEFTMRETLIYFGIISAMSKGDIEDRTEFLLKLLNLPNASKFV-- 180
                    :||.:.||..|:.. :::|.:.|         |......|.:.|...|.|||||:  
plant   480 --------KIGLVSQEPVLFTS-SIKENIAY---------GKENATVEEIRKATELANASKFIDK 526

  Fly   181 -------------KNLSGGQQRRVSLAVALLHEPELLILDEPTVGVDPVLRQSIWDHLVDITKNG 232
                         ..|||||::|:::|.|:|.:|.:|:|||.|..:|....:.:.:.|..|..| 
plant   527 LPQGLDTMVGEHGTQLSGGQKQRIAVARAILKDPRILLLDEATSALDAESERIVQEALDRIMVN- 590

  Fly   233 HTTVIITTHYIDECAQAHMIGLLRGGKMLAEES-PDYLRQQYNADSLEDVFLKLSVLQNMGKRRR 296
            .|||:: .|.:.....|.||.::..||::.:.| .:.||..      |..:.:|..||...|:..
plant   591 RTTVVV-AHRLSTVRNADMIAVIHQGKIVEKGSHSELLRDP------EGAYSQLIRLQEDTKQTE 648

  Fly   297 SSIAQE--IVEQVTVPAISNPALDMSDEQHAAEISGEFG-----DNISMSSAARD-PISTTAPAA 353
            .|..::  .:|.:...::...:|..|..:.::..| .||     |..:.:...:| .:||     
plant   649 DSTDEQKLSMESMKRSSLRKSSLSRSLSKRSSSFS-MFGFPAGIDTNNEAIPEKDIKVST----- 707

  Fly   354 PPLPPPQEIPTSFWYNLHVMQSHHLHALIWKNFLWMMRNVGVMLFIVGLPVVQIL 408
                |.:|...|| :.:..:....:..||..:...::.  ||:|.|.|:.:..::
plant   708 ----PIKEKKVSF-FRVAALNKPEIPMLILGSIAAVLN--GVILPIFGILISSVI 755

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33970NP_001034071.1 P-loop_NTPase 48..270 CDD:304359 61/232 (26%)
CcmA 54..321 CDD:224054 71/285 (25%)
ABC2_membrane_3 394..770 CDD:289468 5/15 (33%)
ABC2_membrane <581..738 CDD:279410
ABCB21NP_001327192.1 PTZ00265 16..1290 CDD:240339 90/380 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.