DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33970 and Abca14

DIOPT Version :9

Sequence 1:NP_001034071.1 Gene:CG33970 / 43186 FlyBaseID:FBgn0053970 Length:777 Species:Drosophila melanogaster
Sequence 2:XP_038957098.1 Gene:Abca14 / 365362 RGDID:1561491 Length:1691 Species:Rattus norvegicus


Alignment Length:228 Identity:72/228 - (31%)
Similarity:128/228 - (56%) Gaps:5/228 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VCVRRAHKMYGSSKNPNVVLDGLNMTVPKGSIYGLLGASGCGKTTLLSCIVGRRRLNSGEIWVLG 112
            |.:::..|:|.... |.:.:..:::|:.|...:||||.:|.||||....:.|.....||:::: .
  Rat  1365 VLIKKLIKIYFKIP-PTLAVRNISLTIQKEECFGLLGLNGAGKTTTFKILTGEEIATSGDVFI-E 1427

  Fly   113 GRPGSRGSGVPGPRIGYMPQEIALYGEFTMRETLIYFGIISAMSKGDIEDRTEFLLKLLNL-PNA 176
            |...:|.......:|||.||..||....|.||.|..:..:..:.:.:|......|||:|.| |.|
  Rat  1428 GYSITRNILKVRSKIGYCPQFDALLDYMTSREILTMYARVWGIPENNIRSYVNNLLKMLYLKPQA 1492

  Fly   177 SKFVKNLSGGQQRRVSLAVALLHEPELLILDEPTVGVDPVLRQSIWDHLVDITKNGHTTVIITTH 241
            .||:..||||.:||:|.|:|::....::.||||:.|:||:.|:.:|:.::...::| ..:|||:|
  Rat  1493 EKFIYTLSGGNKRRLSTAIAIMGNSSVVFLDEPSTGMDPLARRMLWNAVIRTRESG-KVIIITSH 1556

  Fly   242 YIDEC-AQAHMIGLLRGGKMLAEESPDYLRQQY 273
            .::|| |....:.::..||::...||.:|:.::
  Rat  1557 SMEECEALCTRLAIMVQGKLVCLGSPQHLKNKF 1589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33970NP_001034071.1 P-loop_NTPase 48..270 CDD:304359 71/223 (32%)
CcmA 54..321 CDD:224054 71/222 (32%)
ABC2_membrane_3 394..770 CDD:289468
ABC2_membrane <581..738 CDD:279410
Abca14XP_038957098.1 rim_protein <100..1681 CDD:130324 72/228 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.