DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33970 and CG1494

DIOPT Version :9

Sequence 1:NP_001034071.1 Gene:CG33970 / 43186 FlyBaseID:FBgn0053970 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_001259763.1 Gene:CG1494 / 33102 FlyBaseID:FBgn0031169 Length:1695 Species:Drosophila melanogaster


Alignment Length:222 Identity:64/222 - (28%)
Similarity:104/222 - (46%) Gaps:39/222 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NVVLDGLNMTVPKGSIYGLLGASGCGKTTLLSCIVGRRRLNSGEIWVLGGRPGSRGSGVPGPR-- 126
            |.||..|:.|:.|.....:.||:..||||||..:|...::|:|::|:       ....|...|  
  Fly  1374 NRVLRDLDFTLAKSECLSITGANNSGKTTLLKVVVNETKMNAGQLWI-------HDYSVNTHRVQ 1431

  Fly   127 ----IGYMPQEIALYGEFTMRETLIYFGIISAMSKGDI----EDRTEFLLKLLNL-PNASKFVKN 182
                :||.||:.:|..|||.|| |:|   |.||.:|..    .:.:|.||:|:.| |..::.|:.
  Fly  1432 CYRMVGYCPQKDSLPSEFTPRE-LLY---IHAMLQGHRHRIGRELSEALLRLVGLTPCWNRSVRM 1492

  Fly   183 LSGGQQRRVSLAVALLHEPELLILDEPTVGVDPVLRQSIWDHLVDITKNGHTTVIITTHYIDECA 247
            .:.||.||:..|.|:|..|:|:.:|....|:||               .|...:::.|..:....
  Fly  1493 CTTGQIRRLYFAYAVLGSPDLICVDGVPAGLDP---------------TGKRIILMMTSTMQAMG 1542

  Fly   248 QAHMIGLLRG--GKMLAEESPDYLRQQ 272
            .:.:..:|.|  .:.|:..:|..|..|
  Fly  1543 SSFLYTMLTGLDAERLSLRTPLLLEGQ 1569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33970NP_001034071.1 P-loop_NTPase 48..270 CDD:304359 62/218 (28%)
CcmA 54..321 CDD:224054 64/222 (29%)
ABC2_membrane_3 394..770 CDD:289468
ABC2_membrane <581..738 CDD:279410
CG1494NP_001259763.1 ABC2_membrane_3 <263..480 CDD:289468
CcmA 541..848 CDD:224054
ABC_subfamily_A 541..761 CDD:213230
ABC2_membrane_3 911..>1189 CDD:289468
ABC2_membrane <1080..>1188 CDD:304374
ABC_subfamily_A 1370..1577 CDD:213230 64/222 (29%)
PRK14255 1371..1586 CDD:172743 64/222 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.