DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33970 and Abca3

DIOPT Version :9

Sequence 1:NP_001034071.1 Gene:CG33970 / 43186 FlyBaseID:FBgn0053970 Length:777 Species:Drosophila melanogaster
Sequence 2:XP_006246101.1 Gene:Abca3 / 302973 RGDID:1307174 Length:1704 Species:Rattus norvegicus


Alignment Length:364 Identity:102/364 - (28%)
Similarity:173/364 - (47%) Gaps:59/364 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DLDLA-ARRRLFISQPSTLATRRQQAVCVRRAHKMYGSSKNPNVVLDGLNMTVPKGSIYGLLGAS 86
            |.|:| .|.|:.:  || |.:.....:.:....|:| ..:.|.:.:|.:::.|.||..:||||.:
  Rat  1358 DQDVADERSRVLV--PS-LDSMLDTPLIINELSKVY-DQRAPLLAVDRISLAVQKGECFGLLGFN 1418

  Fly    87 GCGKTTLLSCIVGRRRLNSGEIWVLGGRPGSRGSGVPGPRIGYMPQEIALYGEFTMRETLIYFGI 151
            |.||||....:.|...:.||:.:| ||...|...|....|:||.||..||....|.||.|:.:..
  Rat  1419 GAGKTTTFKMLTGEETITSGDAFV-GGYSISSDIGKVRQRMGYCPQFDALLDHMTGREMLVMYAR 1482

  Fly   152 ISAMSKGDIEDRTEFLLK-LLNLPNASKFVKNLSGGQQRRVSLAVALLHEPELLILDEPTVGVDP 215
            :..:.:..|:...|..|: ||..|:|:|.||..|||.:|::|..:||:.||.::.||||:.|:||
  Rat  1483 LRGIPERLIDACVENTLRGLLLEPHANKLVKTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDP 1547

  Fly   216 VLRQSIWDHLVDITKNGHTTVIITTHYIDEC-AQAHMIGLLRGGKMLAEESPDYLRQQYNADSLE 279
            |.|:.:||.:....::| ..::||:|.::|| |....:.::..|:.....||.:|:.::.:.   
  Rat  1548 VARRLLWDTVARARESG-KAIVITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSG--- 1608

  Fly   280 DVFLKLSVLQNMGKRRRSSIAQEIVEQ------VTVPA------------ISNPALDMS------ 320
                     .::..:.||...||::|:      :|.|.            ...|..|:|      
  Rat  1609 ---------YSLQAKVRSEGKQEVLEEFKAFVDLTFPGSVLEDEHQDMVHYHLPGCDLSWAKVFG 1664

  Fly   321 -----------DEQHAAEISGEFGDNISMSSAARDPIST 348
                       |:...::||.|   .:.:|.|...|.:|
  Rat  1665 ILEKAKEKYGVDDYSVSQISLE---QVFLSFAHLQPPTT 1700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33970NP_001034071.1 P-loop_NTPase 48..270 CDD:304359 75/223 (34%)
CcmA 54..321 CDD:224054 86/303 (28%)
ABC2_membrane_3 394..770 CDD:289468
ABC2_membrane <581..738 CDD:279410
Abca3XP_006246101.1 rim_protein <206..1699 CDD:130324 101/361 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.