DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33970 and Abca5

DIOPT Version :9

Sequence 1:NP_001034071.1 Gene:CG33970 / 43186 FlyBaseID:FBgn0053970 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_671752.2 Gene:Abca5 / 217265 MGIID:2386607 Length:1642 Species:Mus musculus


Alignment Length:275 Identity:78/275 - (28%)
Similarity:136/275 - (49%) Gaps:13/275 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NSDLDLAARRRLFISQPSTLATRRQQAVCVRRAHKMYG-------SSKNPNVVLDGLNMTVPKGS 78
            :.|.|:.|.|..............:.|:.|...||.|.       |.|...|....::..|.||.
Mouse  1263 DEDEDVKAERLKVKELMGCQCCEEKPAIMVCNLHKEYDDKKDFLHSRKTTKVATKYISFCVKKGE 1327

  Fly    79 IYGLLGASGCGKTTLLSCIVGRRRLNSGEIWVLGGRPGSRGS--GVPGPRIGYMPQEIALYGEFT 141
            |.||||.:|.||:|:::.:||.....||:|::  |..||..|  ......:||.||...|:.:.|
Mouse  1328 ILGLLGPNGAGKSTVINTLVGDVEPTSGKIFL--GDYGSHSSEDDESIKCMGYCPQTNPLWPDLT 1390

  Fly   142 MRETLIYFGIISAMSKGDIEDRTEFLLKLLNL-PNASKFVKNLSGGQQRRVSLAVALLHEPELLI 205
            ::|....:|.:..||.||:::....:.|.|:| .:..|.||.|..|.:|::..|:::|..|::.:
Mouse  1391 LQEHFEIYGAVKGMSPGDMKEVISRITKALDLKEHLQKTVKKLPAGIKRKLCFALSMLGNPQVTL 1455

  Fly   206 LDEPTVGVDPVLRQSIWDHLVDITKNGHTTVIITTHYIDEC-AQAHMIGLLRGGKMLAEESPDYL 269
            ||||:.|:||..:|.:|..:....||.....::||||::|. |....:.::..|::....:..:|
Mouse  1456 LDEPSTGMDPRAKQHMWRAIRTAFKNKKRAALLTTHYMEEAEAVCDRVAIMVSGQLRCIGTVQHL 1520

  Fly   270 RQQYNADSLEDVFLK 284
            :.::......::.||
Mouse  1521 KSKFGKGYFLEIKLK 1535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33970NP_001034071.1 P-loop_NTPase 48..270 CDD:304359 70/232 (30%)
CcmA 54..321 CDD:224054 72/242 (30%)
ABC2_membrane_3 394..770 CDD:289468
ABC2_membrane <581..738 CDD:279410
Abca5NP_671752.2 rim_protein <84..1618 CDD:130324 78/275 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.