DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33970 and ABCA3

DIOPT Version :9

Sequence 1:NP_001034071.1 Gene:CG33970 / 43186 FlyBaseID:FBgn0053970 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_001080.2 Gene:ABCA3 / 21 HGNCID:33 Length:1704 Species:Homo sapiens


Alignment Length:291 Identity:93/291 - (31%)
Similarity:152/291 - (52%) Gaps:29/291 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DLDLA-ARRRLFISQPSTLATRRQQAVCVRRAHKMYGSSKNPNVVLDGLNMTVPKGSIYGLLGAS 86
            |.|:| .|.|:....|.:|.   ...:.::...|:| ..:.|.:.:|.|::.|.||..:||||.:
Human  1358 DQDVADERTRILAPSPDSLL---HTPLIIKELSKVY-EQRVPLLAVDRLSLAVQKGECFGLLGFN 1418

  Fly    87 GCGKTTLLSCIVGRRRLNSGEIWVLGGRPGSRGSGVPGPRIGYMPQEIALYGEFTMRETLIYFGI 151
            |.||||....:.|...|.||:.:| ||...|...|....||||.||..||....|.||.|:.:..
Human  1419 GAGKTTTFKMLTGEESLTSGDAFV-GGHRISSDVGKVRQRIGYCPQFDALLDHMTGREMLVMYAR 1482

  Fly   152 ISAMSKGDIEDRTEFLLK-LLNLPNASKFVKNLSGGQQRRVSLAVALLHEPELLILDEPTVGVDP 215
            :..:.:..|....|..|: ||..|:|:|.|:..|||.:|::|..:||:.||.::.||||:.|:||
Human  1483 LRGIPERHIGACVENTLRGLLLEPHANKLVRTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDP 1547

  Fly   216 VLRQSIWDHLVDITKNGHTTVIITTHYIDEC-AQAHMIGLLRGGKMLAEESPDYLRQQYNA---- 275
            |.|:.:||.:....::| ..:|||:|.::|| |....:.::..|:.....||.:|:.::.:    
Human  1548 VARRLLWDTVARARESG-KAIIITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSL 1611

  Fly   276 ----------DSLED--VFLKL----SVLQN 290
                      ::||:  .|:.|    |||::
Human  1612 RAKVQSEGQQEALEEFKAFVDLTFPGSVLED 1642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33970NP_001034071.1 P-loop_NTPase 48..270 CDD:304359 78/223 (35%)
CcmA 54..321 CDD:224054 86/259 (33%)
ABC2_membrane_3 394..770 CDD:289468
ABC2_membrane <581..738 CDD:279410
ABCA3NP_001080.2 ABC2_membrane_3 <271..469 CDD:289468
CcmA 530..839 CDD:224054
ABC_subfamily_A 530..751 CDD:213230
ABC2_membrane_3 923..1261 CDD:289468
ABC_subfamily_A 1381..1602 CDD:213230 78/223 (35%)
drrA 1397..1692 CDD:130256 83/248 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.