DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33970 and ABCA2

DIOPT Version :9

Sequence 1:NP_001034071.1 Gene:CG33970 / 43186 FlyBaseID:FBgn0053970 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_997698.1 Gene:ABCA2 / 20 HGNCID:32 Length:2466 Species:Homo sapiens


Alignment Length:401 Identity:105/401 - (26%)
Similarity:175/401 - (43%) Gaps:65/401 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PPTAPAATATTANSDLDLAARRRLFISQPSTLATRRQQAVCVRRAHKMYGSSKNPNVV-LDGLNM 72
            |...|.:| .....|:|:|:.|:..:...:.     ...|.:....|:|.|.|...:: :|.|.:
Human  2048 PQRMPVST-KPVEDDVDVASERQRVLRGDAD-----NDMVKIENLTKVYKSRKIGRILAVDRLCL 2106

  Fly    73 TVPKGSIYGLLGASGCGKTTLLSCIVGRRRLNSGEIWVLGGRPGSRGSGV------PGPRIGYMP 131
            .|..|..:||||.:|.|||:....:.|......||.:|       .|..|      ....:||.|
Human  2107 GVRPGECFGLLGVNGAGKTSTFKMLTGDESTTGGEAFV-------NGHSVLKELLQVQQSLGYCP 2164

  Fly   132 QEIALYGEFTMRETLIYFGIISAMSKGDIEDRTEFLLKLLNLPN-ASKFVKNLSGGQQRRVSLAV 195
            |..||:.|.|.||.|..:..:..:|..|.....::.|:.|.|.. |.|.....|||.:|::|.|:
Human  2165 QCDALFDELTAREHLQLYTRLRGISWKDEARVVKWALEKLELTKYADKPAGTYSGGNKRKLSTAI 2229

  Fly   196 ALLHEPELLILDEPTVGVDPVLRQSIWDHLVDITKNGHTTVIITTHYIDEC-AQAHMIGLLRGGK 259
            ||:..|..:.|||||.|:||..|:.:|:.::|:.|.|. :|::|:|.::|| |....:.::..|:
Human  2230 ALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGR-SVVLTSHSMEECEALCTRLAIMVNGR 2293

  Fly   260 MLAEESPDYLRQQY-----------NADSLEDV--FLKLSVLQNMGKRRRS------------SI 299
            :....|..:|:.::           ::.|::||  |...:..:.|.|.|..            |:
Human  2294 LRCLGSIQHLKNRFGDGYMITVRTKSSQSVKDVVRFFNRNFPEAMLKERHHTKVQYQLKSEHISL 2358

  Fly   300 AQEI--VEQVTVP------AISNPALDMSDEQHAAEISGEFGDNISMS-----SAARDPISTTAP 351
            ||..  :|||:..      ::|...||......|.:.|    ||:...     ||.:.|:.....
Human  2359 AQVFSKMEQVSGVLGIEDYSVSQTTLDNVFVNFAKKQS----DNLEQQETEPPSALQSPLGCLLS 2419

  Fly   352 AAPPLPPPQEI 362
            ...|...|.|:
Human  2420 LLRPRSAPTEL 2430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33970NP_001034071.1 P-loop_NTPase 48..270 CDD:304359 71/230 (31%)
CcmA 54..321 CDD:224054 87/308 (28%)
ABC2_membrane_3 394..770 CDD:289468
ABC2_membrane <581..738 CDD:279410
ABCA2NP_997698.1 rim_protein 58..2398 CDD:130324 97/367 (26%)
ABC_subfamily_A 1021..1240 CDD:213230
ABC_subfamily_A 2081..2304 CDD:213230 71/230 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.