DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33970 and wht-1

DIOPT Version :9

Sequence 1:NP_001034071.1 Gene:CG33970 / 43186 FlyBaseID:FBgn0053970 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_001348731.1 Gene:wht-1 / 175859 WormBaseID:WBGene00015479 Length:671 Species:Caenorhabditis elegans


Alignment Length:431 Identity:98/431 - (22%)
Similarity:163/431 - (37%) Gaps:125/431 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 MYGSSKN-------PNVVLDGLNMTVPK----------------GSIYGLLGASGCGKTTLLSCI 97
            :|.||.|       |...:|.....:||                |.:..:||:||.|||||::.:
 Worm    49 LYWSSLNVTGPETKPTNFVDRFRNNMPKRRVKEILHNVSGMAESGKLLAILGSSGAGKTTLMNVL 113

  Fly    98 VGRRRLN---SGEIWVLGGRPGSRGSGVPGPRI----GYMPQEIALYGEFTMRETLIYFGIISAM 155
            ..|...|   .|.| ::.||..::.      :|    .::.|.....|..|.||.|.:   ::.:
 Worm   114 TSRNLTNLDVQGSI-LIDGRRANKW------KIREMSAFVQQHDMFVGTMTAREHLQF---MARL 168

  Fly   156 SKGD-----------IED-RTEFLLK-----LLNLPNASKFVKNLSGGQQRRVSLAVALLHEPEL 203
            ..||           :|. .|:..||     ::.:||.   :|.||.|:::|:|.|..:|..|::
 Worm   169 RMGDQYYSDHERQLRVEQVLTQMGLKKCADTVIGIPNQ---LKGLSCGEKKRLSFASEILTCPKI 230

  Fly   204 LILDEPTVGVDPVLRQSIWDHLVDITKNGHTTVIITTHYIDECAQAHMIGLLRGGKMLAEESPDY 268
            |..||||.|:|..:...:...|..:..|| .|||||.|.    ..:|:..|.....::|.....|
 Worm   231 LFCDEPTSGLDAFMAGHVVQALRSLADNG-MTVIITIHQ----PSSHVYSLFNNVCLMACGRVIY 290

  Fly   269 LRQQYNADSLEDVFLKLSVLQNMGKRRRSSIAQEIVEQVTVPAISNPA------LDMSDEQHAAE 327
            |..   .|....:|.|..                    ...||..|||      |.:.|...|..
 Worm   291 LGP---GDQAVPLFEKCG--------------------YPCPAYYNPADHLIRTLAVIDSDRATS 332

  Fly   328 -----------ISGEFGDNI-------SMSSAARDPISTTAPAAPPLPPPQEIPTSFWYNLHVMQ 374
                       :|.:.|.::       .:.:|:....|.|:...... ..|:...|||       
 Worm   333 MKTISKIRQGFLSTDLGQSVLAIGNANKLRAASFVTGSDTSEKTKTF-FNQDYNASFW------- 389

  Fly   375 SHHLHALIWKNFLWMMRNVGVMLFIVGLPVVQILLFCYAIG 415
             ....||.|:::|.::|:..    ::.:.::|||:..:..|
 Worm   390 -TQFLALFWRSWLTVIRDPN----LLSVRLLQILITAFITG 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33970NP_001034071.1 P-loop_NTPase 48..270 CDD:304359 68/260 (26%)
CcmA 54..321 CDD:224054 78/317 (25%)
ABC2_membrane_3 394..770 CDD:289468 4/22 (18%)
ABC2_membrane <581..738 CDD:279410
wht-1NP_001348731.1 3a01204 76..667 CDD:273361 91/404 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.