DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33970 and abt-2

DIOPT Version :9

Sequence 1:NP_001034071.1 Gene:CG33970 / 43186 FlyBaseID:FBgn0053970 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_490949.3 Gene:abt-2 / 171782 WormBaseID:WBGene00000020 Length:2146 Species:Caenorhabditis elegans


Alignment Length:367 Identity:100/367 - (27%)
Similarity:166/367 - (45%) Gaps:67/367 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LFISQPST-----LATRRQQ------------AVCVRRAHKMYGSSKNPNVV-LDGLNMTVPKGS 78
            :.:.:|||     :...||:            |:.||...|.|    ||.:: :.|::..|..|.
 Worm  1769 MMLREPSTCDDEDVVKERQRVDAIPMDSSDNHALIVRNLAKAY----NPELLAVKGISFAVEPGE 1829

  Fly    79 IYGLLGASGCGKTTLLSCIVGRRRLNSGEIWVLGGR--PGSRGSGVPGPRIGYMPQEIALYGEFT 141
            .:||||.:|.||||..:.:..:.|...|.|.:...|  .||........::||.||..||..:.:
 Worm  1830 CFGLLGLNGAGKTTTFAMLTAKIRPGHGSIEMQNTRINTGSFSDVRNFQQLGYCPQFDALNMKLS 1894

  Fly   142 MRETLIYFGIISAMSKGDIEDRTEFLLKLLNL-PNASKFVKNLSGGQQRRVSLAVALLHEPELLI 205
            .||.|.::..|..:....|:...:.||..|:| |.|:....:||||.:|::|:||||:.:|.|:.
 Worm  1895 TRENLKFYARIRGIVPTQIDSIIDRLLIALHLRPYANTQTSSLSGGNRRKLSVAVALVSQPSLIF 1959

  Fly   206 LDEPTVGVDPVLRQSIWDHLVDITKNGHTTVIITTHYIDEC-AQAHMIGLLRGGKMLAEESPDYL 269
            ||||:.|:||..:|.:|..:..:.|:| ..|::|:|.::|| |....|.::..|::.......:|
 Worm  1960 LDEPSAGMDPGSQQFLWKVIERLCKSG-KAVVLTSHSMEECEALCTRIAIMDRGRIRCLGGKQHL 2023

  Fly   270 RQQYNADSLEDVFLKLSVLQNMGKRRRSSIAQEIV--------EQVTVPAISNPALDMSDEQHAA 326
            :.:|...|:        :...|||...   |:||.        :...|.||....:.:..||..|
 Worm  2024 KSKYGKGSM--------LTMKMGKDEN---AKEIAGIMRSKLGDGSRVEAIHCSTIFIHIEQGTA 2077

  Fly   327 EIS---------------GEFG------DNISMSSAARDPIS 347
            .::               .:|.      ||:..|.|..|.:|
 Worm  2078 SVARVLEIVNQVKKMYDVDDFTLTQSTLDNVFQSIAESDNLS 2119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33970NP_001034071.1 P-loop_NTPase 48..270 CDD:304359 72/226 (32%)
CcmA 54..321 CDD:224054 82/279 (29%)
ABC2_membrane_3 394..770 CDD:289468
ABC2_membrane <581..738 CDD:279410
abt-2NP_490949.3 rim_protein 39..2117 CDD:130324 98/363 (27%)
ABC_subfamily_A 929..1134 CDD:213230
ABC_subfamily_A 1802..2024 CDD:213230 72/226 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.