DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33970 and Abca1

DIOPT Version :9

Sequence 1:NP_001034071.1 Gene:CG33970 / 43186 FlyBaseID:FBgn0053970 Length:777 Species:Drosophila melanogaster
Sequence 2:XP_006537617.1 Gene:Abca1 / 11303 MGIID:99607 Length:2263 Species:Mus musculus


Alignment Length:337 Identity:86/337 - (25%)
Similarity:152/337 - (45%) Gaps:73/337 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VRRAHKMYGSSKNPNVVLDGLNMTVPKGSIYGLLGASGCGKTTLLSCIVGRRRLNSGEIWVLGGR 114
            ::...|:|...:.|.|  |.:.:.:|.|..:||||.:|.||:|....:.|...:..|:.::    
Mouse  1916 IKELTKIYRRKRKPAV--DRICIGIPPGECFGLLGVNGAGKSTTFKMLTGDTPVTRGDAFL---- 1974

  Fly   115 PGSRGSGVPG-----PRIGYMPQEIALYGEFTMRETLIYFGIISAMSKGDIEDRTEFLLKLLNLP 174
              ::.|.:..     ..:||.||..|:....|.||.:.:|.::..:.:.::....|:.::.|.|.
Mouse  1975 --NKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLV 2037

  Fly   175 N-ASKFVKNLSGGQQRRVSLAVALLHEPELLILDEPTVGVDPVLRQSIWDHLVDITKNGHTTVII 238
            . ..|:..|.|||.:|::|.|:||:..|.::.|||||.|:||..|:.:|:..:.|.|.|. :|::
Mouse  2038 KYGEKYASNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSIVKEGR-SVVL 2101

  Fly   239 TTHYIDEC-------------------AQAHM---------------------------IGLLRG 257
            |:|.::||                   :..|:                           .||...
Mouse  2102 TSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQEFFGLAFP 2166

  Fly   258 GKMLAEESPDYLRQQY--NADSLEDVFLKLSVLQNMGKR---RRSSIAQEIVEQVTVPAISNPAL 317
            |.:|.|:..:.|:.|.  :..||..:|   |:|....||   ...|::|..::||.|    |.|.
Mouse  2167 GSVLKEKHRNMLQYQLPSSLSSLARIF---SILSQSKKRLHIEDYSVSQTTLDQVFV----NFAK 2224

  Fly   318 DMSDEQHAAEIS 329
            |.||:.|..::|
Mouse  2225 DQSDDDHLKDLS 2236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33970NP_001034071.1 P-loop_NTPase 48..270 CDD:304359 65/271 (24%)
CcmA 54..321 CDD:224054 82/323 (25%)
ABC2_membrane_3 394..770 CDD:289468
ABC2_membrane <581..738 CDD:279410
Abca1XP_006537617.1 rim_protein 6..2238 CDD:130324 86/337 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.